Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G63270 80 / 1e-20 ABCI1, ATNAP10 ATP-binding cassette I1, non-intrinsic ABC protein 10 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10022692 [exp] 89 / 5e-24 AT1G63270 403 / 8e-145 ATP-binding cassette I1, non-intrinsic ABC protein 10 (.1) Lus10006727 [exp] 89 / 1e-23 AT1G63270 404 / 3e-145 ATP-binding cassette I1, non-intrinsic ABC protein 10 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.018G110200 [exp] 81 / 6e-21 AT1G63270 387 / 2e-138 ATP-binding cassette I1, non-intrinsic ABC protein 10 (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10040034 pacid=23173536 polypeptide=Lus10040034 locus=Lus10040034.g ID=Lus10040034.BGIv1.0 annot-version=v1.0 ATGGATGGGCCTATTTGGTTGTTGGATGAGCCTTCTGTTGCGCTGGACGATGATGGCGTGAAGGTGCTTGAGTTCATAATCACAGAGCACGGGCAGAAAG GCGGGATTGTGATCGTGACGACACATTTTCCAATCAAGATTGACACCCAGATTCCCTAG
AA sequence Show only first row Show all	>Lus10040034 pacid=23173536 polypeptide=Lus10040034 locus=Lus10040034.g ID=Lus10040034.BGIv1.0 annot-version=v1.0 MDGPIWLLDEPSVALDDDGVKVLEFIITEHGQKGGIVIVTTHFPIKIDTQIP

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G63270		ABCI1, ATNAP10	ATP-binding cassette I1, non-i...		Lus10040034 [exp]	0	1
AT1G23200			Plant invertase/pectin methyle...		Lus10009110 [exp]	9.4	0.7345
					Lus10034388 [exp]	16.4	0.7416
AT2G42005			Transmembrane amino acid trans...		Lus10013835 [exp]	31.4	0.7018
AT2G36640		ATECP63	embryonic cell protein 63 (.1)		Lus10035586 [exp]	37.5	0.6975
AT4G00750			S-adenosyl-L-methionine-depend...		Lus10027433 [exp]	44.4	0.6824
					Lus10035428 [exp]	44.9	0.6674
					Lus10011759 [exp]	47.4	0.6824
AT2G20420			ATP citrate lyase (ACL) family...		Lus10024923 [exp]	50.3	0.6824
AT4G24975			Plant self-incompatibility pro...		Lus10032383 [exp]	53.0	0.6824
					Lus10017303 [exp]	55.6	0.6824

Compare expression of checked genes

Lus10040034 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.