Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G55050 97 / 2e-25 GDSL-like Lipase/Acylhydrolase superfamily protein (.1) AT5G08460 66 / 2e-14 GDSL-like Lipase/Acylhydrolase superfamily protein (.1) AT4G16230 65 / 4e-14 GDSL-like Lipase/Acylhydrolase superfamily protein (.1) AT3G16370 66 / 5e-14 GDSL-like Lipase/Acylhydrolase superfamily protein (.1) AT3G50400 66 / 6e-14 GDSL-like Lipase/Acylhydrolase superfamily protein (.1) AT1G75890 65 / 6e-14 EXL2 GDSL-like Lipase/Acylhydrolase superfamily protein (.1.2) AT1G20120 65 / 6e-14 GDSL-like Lipase/Acylhydrolase superfamily protein (.1) AT5G45960 65 / 6e-14 GDSL-like Lipase/Acylhydrolase superfamily protein (.1) AT5G18430 65 / 7e-14 GDSL-like Lipase/Acylhydrolase superfamily protein (.1) AT3G53100 65 / 8e-14 GDSL-like Lipase/Acylhydrolase superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10021540 [exp] 132 / 8e-39 AT5G55050 357 / 5e-122 GDSL-like Lipase/Acylhydrolase superfamily protein (.1) Lus10021542 [exp] 100 / 9e-29 AT5G55050 115 / 9e-32 GDSL-like Lipase/Acylhydrolase superfamily protein (.1) Lus10023980 [exp] 86 / 2e-21 AT5G55050 215 / 1e-66 GDSL-like Lipase/Acylhydrolase superfamily protein (.1) Lus10025104 [exp] 84 / 1e-20 AT5G55050 211 / 3e-65 GDSL-like Lipase/Acylhydrolase superfamily protein (.1) Lus10025105 [exp] 83 / 2e-20 AT5G55050 233 / 2e-73 GDSL-like Lipase/Acylhydrolase superfamily protein (.1) Lus10023979 [exp] 83 / 2e-20 AT5G55050 229 / 5e-72 GDSL-like Lipase/Acylhydrolase superfamily protein (.1) Lus10041877 [exp] 76 / 8e-18 AT3G14820 321 / 1e-108 GDSL-like Lipase/Acylhydrolase superfamily protein (.1) Lus10028423 [exp] 76 / 8e-18 AT3G14820 317 / 7e-107 GDSL-like Lipase/Acylhydrolase superfamily protein (.1) Lus10028424 [exp] 75 / 2e-17 AT3G14820 298 / 2e-99 GDSL-like Lipase/Acylhydrolase superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.011G089700 [exp] 97 / 1e-25 AT5G55050 375 / 3e-129 GDSL-like Lipase/Acylhydrolase superfamily protein (.1) Potri.004G180400 [exp] 79 / 5e-19 AT4G28780 200 / 4e-61 GDSL-like Lipase/Acylhydrolase superfamily protein (.1) Potri.019G067600 [exp] 70 / 2e-15 AT1G71250 473 / 9e-168 GDSL-like Lipase/Acylhydrolase superfamily protein (.1) Potri.005G104900 [exp] 68 / 7e-15 AT5G55050 209 / 7e-64 GDSL-like Lipase/Acylhydrolase superfamily protein (.1) Potri.009G151000 [exp] 67 / 1e-14 AT5G22810 504 / 0.0 GDSL-like Lipase/Acylhydrolase superfamily protein (.1) Potri.008G104600 [exp] 66 / 5e-14 AT2G23540 370 / 3e-127 GDSL-like Lipase/Acylhydrolase superfamily protein (.1) Potri.004G064500 [exp] 64 / 2e-13 AT1G29670 527 / 0.0 GDSL-like Lipase/Acylhydrolase superfamily protein (.1) Potri.019G024700 [exp] 64 / 2e-13 AT5G33370 549 / 0.0 GDSL-like Lipase/Acylhydrolase superfamily protein (.1.2) Potri.001G191400 [exp] 64 / 2e-13 AT3G16370 508 / 0.0 GDSL-like Lipase/Acylhydrolase superfamily protein (.1) Potri.001G191600 [exp] 63 / 3e-13 AT3G16370 410 / 1e-142 GDSL-like Lipase/Acylhydrolase superfamily protein (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10040065 pacid=23173431 polypeptide=Lus10040065 locus=Lus10040065.g ID=Lus10040065.BGIv1.0 annot-version=v1.0 ATGGGTTCATCAGTAGTAAAAGTCCTAGTACTGCTGTTGGCATCGGCCGTCGGCCTAGTGATGAAGGCGACCTCGACGGAGGGACAGATGGTGCCTGCGG TGTACGTGCTCGGTGACTCGCTGGTTGACGTCGGGACCAATAATTACTTGGCAGTGTCGTTGGCGAAAGCTAATTTCCCTCACAATGGGATTGATTTCCC AAACAAGCACCCAACAGGAAGGTTCTGTAATGGCAAGAATACTGCCGACTGGGTTGGTTAG
AA sequence Show only first row Show all	>Lus10040065 pacid=23173431 polypeptide=Lus10040065 locus=Lus10040065.g ID=Lus10040065.BGIv1.0 annot-version=v1.0 MGSSVVKVLVLLLASAVGLVMKATSTEGQMVPAVYVLGDSLVDVGTNNYLAVSLAKANFPHNGIDFPNKHPTGRFCNGKNTADWVG

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G55050			GDSL-like Lipase/Acylhydrolase...		Lus10040065 [exp]	0	1
AT5G55050			GDSL-like Lipase/Acylhydrolase...		Lus10040064 [exp]	3.0	0.9067
AT3G07880		SCN1	SUPERCENTIPEDE1, Immunoglobuli...		Lus10010491 [exp]	5.3	0.8659
AT5G06060			NAD(P)-binding Rossmann-fold s...		Lus10040735 [exp]	6.3	0.8939
AT5G67090			Subtilisin-like serine endopep...		Lus10009748 [exp]	7.7	0.8870
AT2G16980			Major facilitator superfamily ...		Lus10025087 [exp]	7.7	0.8571
AT2G30990			Protein of unknown function (D...		Lus10029830 [exp]	11.0	0.8901
AT4G40070			RING/U-box superfamily protein...		Lus10043426 [exp]	19.1	0.8700
AT1G51990			O-methyltransferase family pro...		Lus10002668 [exp]	19.2	0.8590
AT4G27960		UBC9	ubiquitin conjugating enzyme 9...		Lus10005072 [exp]	22.9	0.8771
AT5G66900			Disease resistance protein (CC...		Lus10007359 [exp]	23.5	0.8651

Compare expression of checked genes

Lus10040065 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.