Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.011G074067 [exp] 35 / 0.0005 ND /
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10040066 pacid=23173441 polypeptide=Lus10040066 locus=Lus10040066.g ID=Lus10040066.BGIv1.0 annot-version=v1.0 ATGACGGTGCCGAGTGGAAGAGTCGTGGCTCAGCGGATCAAAGTGACTGACGGGATAAAAGGCTTATCTTCCCCTAGAGCTCATATTGATGGGAAGGTTT GGAACCTTGATGTTAGCTCTTCGCCACCTAGGCATGTAGTATGTTCCAAGTGTTGGGTTGTTCGCCCATTAAAGCGGTACGTGAGCTGGGTTTAG
AA sequence Show only first row Show all	>Lus10040066 pacid=23173441 polypeptide=Lus10040066 locus=Lus10040066.g ID=Lus10040066.BGIv1.0 annot-version=v1.0 MTVPSGRVVAQRIKVTDGIKGLSSPRAHIDGKVWNLDVSSSPPRHVVCSKCWVVRPLKRYVSWV

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10040066 [exp]	0	1
					Lus10039759 [exp]	1.0	0.9687
AT3G12660		FLA14	FASCICLIN-like arabinogalactan...		Lus10026107 [exp]	2.8	0.9234
AT4G18380			F-box family protein (.1.2)		Lus10013431 [exp]	5.0	0.8917
AT3G02750			Protein phosphatase 2C family ...		Lus10022683 [exp]	5.1	0.9345
AT5G60900		RLK1	receptor-like protein kinase 1...		Lus10000422 [exp]	6.9	0.8934
AT2G28305		ATLOG1	LONELY GUY 1, Putative lysine ...		Lus10021462 [exp]	8.1	0.8971
AT2G33530		SCPL46	serine carboxypeptidase-like 4...		Lus10040327 [exp]	8.1	0.9100
AT1G12150			Plant protein of unknown funct...		Lus10039107 [exp]	9.3	0.8398
AT1G14750		SDS	SOLO DANCERS, Cyclin family pr...		Lus10021812 [exp]	9.8	0.8301
AT1G47960		ATC/VIF1, C/VIF...	cell wall / vacuolar inhibitor...		Lus10002933 [exp]	10.4	0.9259

Compare expression of checked genes

Lus10040066 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.