Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G32560 38 / 0.0002 AtLEA4-1 Late Embryogenesis Abundant 4-1, Late embryogenesis abundant protein, group 1 protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10030959 [exp] 88 / 4e-23 AT1G32560 98 / 2e-26 Late Embryogenesis Abundant 4-1, Late embryogenesis abundant protein, group 1 protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.003G090501 [exp] 40 / 2e-05 AT1G32560 75 / 2e-18 Late Embryogenesis Abundant 4-1, Late embryogenesis abundant protein, group 1 protein (.1) Potri.001G143700 [exp] 39 / 7e-05 AT1G32560 49 / 2e-08 Late Embryogenesis Abundant 4-1, Late embryogenesis abundant protein, group 1 protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF03760 [flax] [poplar] LEA_1 Late embryogenesis abundant (LEA) group 1
Representative CDS sequence Show only first row Show all	>Lus10040088 pacid=23173803 polypeptide=Lus10040088 locus=Lus10040088.g ID=Lus10040088.BGIv1.0 annot-version=v1.0 ATGCAGAGCGCAAAGCAGAAGATCAGCAACATAGCCAGCGCTGCTAAGGAACGCATCACCATTTGCACCGCTAAAGCTGAAGAACAGGCTGAGAAAGCGA CGGCGACGCCCTCAGAGGAAAGGGAGATAGCCAAGGAGAGGAGGAAGGCCAAGGAAGCCAAAGCCAAGATGGAGCTTCACGAGGCCAAAGCTCGTCACGC TGCTCAGAAATTGACTTCCAGGAATCACCGTTATGGAGCCACAGCCGCCACCGGAGTTCACAACCCGGTTTTTTCCGGTGTTTTTGTTTTTAAATTTCCT TTCTTGGGGGTTTTTTAA
AA sequence Show only first row Show all	>Lus10040088 pacid=23173803 polypeptide=Lus10040088 locus=Lus10040088.g ID=Lus10040088.BGIv1.0 annot-version=v1.0 MQSAKQKISNIASAAKERITICTAKAEEQAEKATATPSEEREIAKERRKAKEAKAKMELHEAKARHAAQKLTSRNHRYGATAATGVHNPVFSGVFVFKFP FLGVF

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G32560		AtLEA4-1	Late Embryogenesis Abundant 4-...		Lus10040088 [exp]	0	1
AT1G18390			Protein kinase superfamily pro...		Lus10027117 [exp]	2.4	0.8854
AT5G39030			Protein kinase superfamily pro...		Lus10027116 [exp]	3.5	0.8718
AT1G12650			unknown protein		Lus10005657 [exp]	6.0	0.8250
AT3G20870		ZTP29	zinc transporter 29, ZIP metal...		Lus10031268 [exp]	6.3	0.8372
AT1G18140		LAC1, ATLAC1	laccase 1 (.1)		Lus10009827 [exp]	7.7	0.8200
AT5G38260			Protein kinase superfamily pro...		Lus10027119 [exp]	8.1	0.8357
AT2G18470		AtPERK4, PERK4	proline-rich extensin-like rec...		Lus10014318 [exp]	8.7	0.7750
AT5G50770		ATHSD6	hydroxysteroid dehydrogenase 6...		Lus10016748 [exp]	8.9	0.8128
AT3G23325			Splicing factor 3B subunit 5/R...		Lus10011813 [exp]	11.8	0.8164
AT3G13040	GARP		myb-like HTH transcriptional r...		Lus10028102 [exp]	12.2	0.8477

Compare expression of checked genes

Lus10040088 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.