Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G32310 88 / 8e-24 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10030955 [exp] 189 / 7e-64 AT1G32310 99 / 3e-28 unknown protein
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G138700 [exp] 127 / 2e-39 AT1G32310 97 / 1e-27 unknown protein Potri.003G095100 [exp] 100 / 7e-29 AT1G32310 91 / 5e-25 unknown protein
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10040092 pacid=23173815 polypeptide=Lus10040092 locus=Lus10040092.g ID=Lus10040092.BGIv1.0 annot-version=v1.0 ATGAATACCTCGCCGGCTCGTTCCTCAGTTTCGACCACGGCGATCGCCGGAGACGGAAGCAGAAGCGCTTTGGAAGATTTCCACATCCCGTCAAATCTCA TCTCCATCCAGGACCGCAAGGATGAGGCTATGCTCGCTGATTTTATGACTGTGTCTGCAATACATTTAGCTTTGAAAGCTGATCTATCAGCTGCACTAAA CAAGGTGGTTGCCTCATTGGATGAAGATAGCTGGAAGTTCGAAGGACCTCGTTCCCGTATAAACCTTGTATCCAGACCTGGTGGGTTTCTAAACAACAAG ATTGAAGCAACCAAGCGTGACAACTACGACGGTCGATCAAAATGA
AA sequence Show only first row Show all	>Lus10040092 pacid=23173815 polypeptide=Lus10040092 locus=Lus10040092.g ID=Lus10040092.BGIv1.0 annot-version=v1.0 MNTSPARSSVSTTAIAGDGSRSALEDFHIPSNLISIQDRKDEAMLADFMTVSAIHLALKADLSAALNKVVASLDEDSWKFEGPRSRINLVSRPGGFLNNK IEATKRDNYDGRSK

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G32310			unknown protein		Lus10040092 [exp]	0	1
AT5G65880			unknown protein		Lus10039652 [exp]	5.1	0.8410
AT1G20430			unknown protein		Lus10034561 [exp]	9.5	0.8079
AT2G28230			TATA-binding related factor (T...		Lus10030654 [exp]	12.2	0.8172
AT2G42680		MBF1A, ATMBF1A	ARABIDOPSIS THALIANA MULTIPROT...		Lus10000056 [exp]	19.0	0.8108
AT1G29990		PFD6, PDF6	prefoldin 6 (.1)		Lus10023313 [exp]	21.4	0.7989
AT3G23390			Zinc-binding ribosomal protein...		Lus10013436 [exp]	30.8	0.7903
AT1G51730			Ubiquitin-conjugating enzyme f...		Lus10037613 [exp]	33.3	0.8090
AT5G64816			unknown protein		Lus10009081 [exp]	34.4	0.8041
AT1G26880			Ribosomal protein L34e superfa...		Lus10042199 [exp]	37.1	0.7744
AT2G18400			ribosomal protein L6 family pr...		Lus10014306 [exp]	43.0	0.7581

Compare expression of checked genes

Lus10040092 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.