Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G59960 96 / 5e-25 NAD(P)-linked oxidoreductase superfamily protein (.1) AT1G59950 94 / 5e-24 NAD(P)-linked oxidoreductase superfamily protein (.1) AT5G62420 81 / 2e-19 NAD(P)-linked oxidoreductase superfamily protein (.1) AT2G37760 77 / 4e-18 AKR4C8 Aldo-keto reductase family 4 member C8, NAD(P)-linked oxidoreductase superfamily protein AT5G01670 74 / 8e-17 NAD(P)-linked oxidoreductase superfamily protein (.1), NAD(P)-linked oxidoreductase superfamily protein (.2) AT2G37790 72 / 5e-16 AKR4C10 Aldo-keto reductase family 4 member C10, NAD(P)-linked oxidoreductase superfamily protein (.1) AT2G21260 71 / 7e-16 NAD(P)-linked oxidoreductase superfamily protein (.1) AT2G37770 69 / 5e-15 ChlAKR, AKR4C9 Chloroplastic aldo-keto reductase, Aldo-keto reductase family 4 member C9, NAD(P)-linked oxidoreductase superfamily protein (.1), NAD(P)-linked oxidoreductase superfamily protein (.2) AT2G21250 67 / 1e-14 NAD(P)-linked oxidoreductase superfamily protein (.1), NAD(P)-linked oxidoreductase superfamily protein (.2) AT3G53880 62 / 2e-12 AKR4C11 Aldo-keto reductase family 4 member C11, NAD(P)-linked oxidoreductase superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10030946 [exp] 196 / 1e-63 AT1G59960 317 / 1e-107 NAD(P)-linked oxidoreductase superfamily protein (.1) Lus10011056 [exp] 131 / 1e-38 AT1G59960 325 / 8e-111 NAD(P)-linked oxidoreductase superfamily protein (.1) Lus10000671 [exp] 123 / 7e-37 AT1G59960 112 / 2e-30 NAD(P)-linked oxidoreductase superfamily protein (.1) Lus10029208 [exp] 120 / 5e-34 AT1G59960 406 / 7e-143 NAD(P)-linked oxidoreductase superfamily protein (.1) Lus10010720 [exp] 120 / 5e-34 AT1G59960 410 / 2e-144 NAD(P)-linked oxidoreductase superfamily protein (.1) Lus10010885 [exp] 78 / 4e-18 AT2G37770 502 / 0.0 Chloroplastic aldo-keto reductase, Aldo-keto reductase family 4 member C9, NAD(P)-linked oxidoreductase superfamily protein (.1), NAD(P)-linked oxidoreductase superfamily protein (.2) Lus10024353 [exp] 73 / 3e-16 AT2G37770 491 / 1e-176 Chloroplastic aldo-keto reductase, Aldo-keto reductase family 4 member C9, NAD(P)-linked oxidoreductase superfamily protein (.1), NAD(P)-linked oxidoreductase superfamily protein (.2) Lus10031739 [exp] 72 / 5e-16 AT5G62420 425 / 2e-150 NAD(P)-linked oxidoreductase superfamily protein (.1) Lus10021491 [exp] 72 / 6e-16 AT2G37770 464 / 2e-166 Chloroplastic aldo-keto reductase, Aldo-keto reductase family 4 member C9, NAD(P)-linked oxidoreductase superfamily protein (.1), NAD(P)-linked oxidoreductase superfamily protein (.2)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.012G040050 [exp] 139 / 9e-44 AT1G59960 135 / 9e-40 NAD(P)-linked oxidoreductase superfamily protein (.1) Potri.008G193100 [exp] 122 / 7e-35 AT1G59960 420 / 3e-148 NAD(P)-linked oxidoreductase superfamily protein (.1) Potri.010G036801 [exp] 110 / 3e-32 AT1G59960 187 / 2e-59 NAD(P)-linked oxidoreductase superfamily protein (.1) Potri.005G097000 [exp] 102 / 3e-27 AT1G59960 405 / 2e-142 NAD(P)-linked oxidoreductase superfamily protein (.1) Potri.016G102300 [exp] 71 / 7e-16 AT2G37770 398 / 5e-140 Chloroplastic aldo-keto reductase, Aldo-keto reductase family 4 member C9, NAD(P)-linked oxidoreductase superfamily protein (.1), NAD(P)-linked oxidoreductase superfamily protein (.2) Potri.016G102032 [exp] 71 / 2e-15 AT2G37770 424 / 2e-150 Chloroplastic aldo-keto reductase, Aldo-keto reductase family 4 member C9, NAD(P)-linked oxidoreductase superfamily protein (.1), NAD(P)-linked oxidoreductase superfamily protein (.2) Potri.016G102100 [exp] 70 / 3e-15 AT2G37770 400 / 5e-141 Chloroplastic aldo-keto reductase, Aldo-keto reductase family 4 member C9, NAD(P)-linked oxidoreductase superfamily protein (.1), NAD(P)-linked oxidoreductase superfamily protein (.2) Potri.009G125100 [exp] 68 / 1e-14 AT2G21250 526 / 0.0 NAD(P)-linked oxidoreductase superfamily protein (.1), NAD(P)-linked oxidoreductase superfamily protein (.2) Potri.001G125400 [exp] 68 / 1e-14 AT5G62420 445 / 2e-158 NAD(P)-linked oxidoreductase superfamily protein (.1) Potri.006G090600 [exp] 64 / 4e-13 AT2G37770 503 / 0.0 Chloroplastic aldo-keto reductase, Aldo-keto reductase family 4 member C9, NAD(P)-linked oxidoreductase superfamily protein (.1), NAD(P)-linked oxidoreductase superfamily protein (.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF00248 [flax] [poplar] Aldo_ket_red Aldo/keto reductase family
Representative CDS sequence Show only first row Show all	>Lus10040101 pacid=23174053 polypeptide=Lus10040101 locus=Lus10040101.g ID=Lus10040101.BGIv1.0 annot-version=v1.0 ATGACAACAATAAAAGTCCCAGAAGTGGAGCTTAGCAGCGGCCGGAAGATGCCGGCGATCGGAATGGGGACGGCAATCATCCCAATCCCGCCGTCGGAGA CTCTGGTATCCGCCTTCCAGGACGCCATTCGGGTAGGGTACCGCCACTTCGACACGGCGTCTCTGTACGGGACGGAGGATAGCCTGGGGAGAGCGGTGGC GGAAGGCGTGGAGAAGGGACTCGTCAAAAGCCGCAACGAGTTGTTTATGACTTCCAAGCTCTGGGTCACCCACACCCACCCCGATCTCGTCCTACCGTCC CTCCAATCCACTCTCCGGTATTTTGAGGATTTTGAGTAA
AA sequence Show only first row Show all	>Lus10040101 pacid=23174053 polypeptide=Lus10040101 locus=Lus10040101.g ID=Lus10040101.BGIv1.0 annot-version=v1.0 MTTIKVPEVELSSGRKMPAIGMGTAIIPIPPSETLVSAFQDAIRVGYRHFDTASLYGTEDSLGRAVAEGVEKGLVKSRNELFMTSKLWVTHTHPDLVLPS LQSTLRYFEDFE

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G59960			NAD(P)-linked oxidoreductase s...		Lus10040101 [exp]	0	1
AT5G44265			Bifunctional inhibitor/lipid-t...		Lus10033667 [exp]	1.0	0.8084
AT5G23960		ATTPS21	terpene synthase 21 (.1.2)		Lus10033188 [exp]	6.0	0.7598
AT3G05610			Plant invertase/pectin methyle...		Lus10020681 [exp]	13.0	0.7237
AT5G64300		ATGCH, ATRIBA1,...	RED FLUORESCENT IN DARKNESS 1,...		Lus10006669 [exp]	18.0	0.7286
AT5G06740			Concanavalin A-like lectin pro...		Lus10029290 [exp]	18.7	0.5976
					Lus10022938 [exp]	21.0	0.7115
					Lus10028788 [exp]	21.8	0.7392
					Lus10002344 [exp]	23.4	0.7201
AT2G25180	GARP	ARR12	response regulator 12 (.1)		Lus10019058 [exp]	24.1	0.7260
					Lus10008904 [exp]	25.7	0.6808

Compare expression of checked genes

Lus10040101 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.