Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G32460 36 / 0.0005 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10030943 [exp] 156 / 4e-51 ND / Lus10011059 [exp] 61 / 7e-13 ND 39 / 1e-04
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G145066 [exp] 58 / 2e-12 AT1G32460 / unknown protein Potri.003G089100 [exp] 52 / 3e-10 AT1G32460 42 / 2e-06 unknown protein Potri.014G179200 [exp] 39 / 3e-05 ND /
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10040104 pacid=23174183 polypeptide=Lus10040104 locus=Lus10040104.g ID=Lus10040104.BGIv1.0 annot-version=v1.0 ATGGAAAAACAGGAAAGGATTGGAGATTATATGGATATAAATTCACCGTACAAAGAGGTTTCTGAGGAGGCGGTTCGGGAGTCGCTCATCTCAATATCTT ATTCGCTTCCGGACACAGCTGTGAACTCTGATGTTAAGTCTGTAACTTTGAGTAACTCGACAGATGATGCGGCTGCTGGATTGAACAACAGCGGGATTGA GAAGTACATGTCTGAACTCATTTCCATTTCCAATACCCAGTCGCTGGATGGTCCTGCAGATTCAGGAAAGCACAAGACTTAG
AA sequence Show only first row Show all	>Lus10040104 pacid=23174183 polypeptide=Lus10040104 locus=Lus10040104.g ID=Lus10040104.BGIv1.0 annot-version=v1.0 MEKQERIGDYMDINSPYKEVSEEAVRESLISISYSLPDTAVNSDVKSVTLSNSTDDAAAGLNNSGIEKYMSELISISNTQSLDGPADSGKHKT

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10040104 [exp]	0	1
AT3G26980		MUB4	membrane-anchored ubiquitin-fo...		Lus10041539 [exp]	2.0	0.8503
AT3G15580		APG8H, ATG8I	AUTOPHAGY 8I, AUTOPHAGY 8H, Ub...		Lus10038046 [exp]	2.0	0.8466
AT1G50670			OTU-like cysteine protease fam...		Lus10040075 [exp]	8.9	0.8321
AT1G14820			Sec14p-like phosphatidylinosit...		Lus10003699 [exp]	12.8	0.8170
AT3G14430			unknown protein		Lus10030201 [exp]	16.0	0.7649
AT4G16710			glycosyltransferase family pro...		Lus10028587 [exp]	16.6	0.7927
AT1G52870			Peroxisomal membrane 22 kDa (M...		Lus10032655 [exp]	17.1	0.7541
AT4G31270	Trihelix		sequence-specific DNA binding ...		Lus10020182 [exp]	17.9	0.7810
AT2G06530		VPS2.1	SNF7 family protein (.1)		Lus10037660 [exp]	19.1	0.8349
AT4G35905			unknown protein		Lus10028420 [exp]	21.9	0.8088

Compare expression of checked genes

Lus10040104 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.