Plant FIBer expression Database

Lus10040105 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G32370 89 / 6e-24 TTM1, TOM2B tobamovirus multiplication 2B (.1.2.3.4)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10030942
[exp]
155 / 3e-50 AT1G32370 98 / 1e-27 tobamovirus multiplication 2B (.1.2.3.4)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.001G145500
[exp]
101 / 7e-29 AT1G32370 133 / 4e-41 tobamovirus multiplication 2B (.1.2.3.4)
PFAM info
Representative CDS sequence
>Lus10040105 pacid=23174037 polypeptide=Lus10040105 locus=Lus10040105.g ID=Lus10040105.BGIv1.0 annot-version=v1.0
ATGGCCGCCTTTGTACCATCGTCCTCAGGCGGTAGTGGAACGGCAAGTATTAATCCACTGTCGGCGACGACAACTAATACTAGAGGAGGCACTGCTAAAG
CTGCGGCACAACTGTCTAAACTTCCGAAGAACCTTCTGGCAAAAGCCTCGACGATAAAGAACACAGGCCAAATTCTCGAGCAGCTGCCGCAGGTGATTTC
AGCATTGGATGCACACATGGAAAGTGGATTGCAAAGTGCTCCTCATCTAAAAACGGTGTCTCAAATACTAGCTAATATGGAAAGTAGTCAGCTTAGTTCC
CTGTCCTCAGCCCGTGTTGCTCAGGAGGTTTAA
AA sequence
>Lus10040105 pacid=23174037 polypeptide=Lus10040105 locus=Lus10040105.g ID=Lus10040105.BGIv1.0 annot-version=v1.0
MAAFVPSSSGGSGTASINPLSATTTNTRGGTAKAAAQLSKLPKNLLAKASTIKNTGQILEQLPQVISALDAHMESGLQSAPHLKTVSQILANMESSQLSS
LSSARVAQEV

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G32370 TTM1, TOM2B tobamovirus multiplication 2B ... Lus10040105
[exp]
0 1
AT4G39100 SHL1 short life, PHD finger family ... Lus10041960
[exp]
5.0 0.8975
AT2G26070 RTE1 REVERSION-TO-ETHYLENE SENSITIV... Lus10030001
[exp]
7.3 0.9079
AT4G10170 SNARE-like superfamily protein... Lus10002944
[exp]
9.1 0.9036
AT3G24490 Trihelix Alcohol dehydrogenase transcri... Lus10019388
[exp]
11.4 0.9010
AT5G03455 ACR2, ARATH;CDC... ARSENATE REDUCTASE 2, Rhodanes... Lus10021515
[exp]
16.5 0.9007
AT5G47090 unknown protein Lus10035047
[exp]
20.3 0.8876
AT4G00620 EMB3127 EMBRYO DEFECTIVE 3127, Amino a... Lus10018843
[exp]
25.9 0.8941
AT1G10150 ATPP2-A10 Carbohydrate-binding protein (... Lus10018663
[exp]
30.2 0.8819
AT5G10860 CBSX3 CBS domain containing protein ... Lus10019117
[exp]
30.6 0.8742
AT5G19140 AtAILP1, AILP1 Aluminium induced protein with... Lus10010505
[exp]
30.7 0.8773

Lus10040105 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.