Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G17020 48 / 3e-08 ATSRG1, SRG1 senescence-related gene 1 (.1) AT4G25300 48 / 4e-08 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2) AT4G25310 48 / 4e-08 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT1G17010 46 / 2e-07 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT3G21420 43 / 2e-06 LBO1 LATERAL BRANCHING OXIDOREDUCTASE 1, 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT1G49390 41 / 8e-06 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT5G20400 36 / 0.0006 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT1G78550 36 / 0.0007 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10030934 [exp] 73 / 7e-17 AT1G17020 337 / 2e-114 senescence-related gene 1 (.1) Lus10030941 [exp] 72 / 7e-17 AT1G17010 258 / 2e-84 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Lus10040112 [exp] 72 / 1e-16 AT1G17020 332 / 1e-112 senescence-related gene 1 (.1) Lus10003652 [exp] 50 / 5e-09 AT4G25300 206 / 3e-64 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2) Lus10011981 [exp] 47 / 1e-07 AT1G17020 375 / 2e-129 senescence-related gene 1 (.1) Lus10022292 [exp] 46 / 2e-07 AT1G17020 449 / 5e-159 senescence-related gene 1 (.1) Lus10004582 [exp] 45 / 3e-07 AT1G17020 231 / 2e-74 senescence-related gene 1 (.1) Lus10026173 [exp] 45 / 6e-07 AT1G17020 443 / 5e-156 senescence-related gene 1 (.1) Lus10011979 [exp] 44 / 8e-07 AT1G17020 374 / 4e-129 senescence-related gene 1 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G355100 [exp] 53 / 8e-10 AT1G17020 439 / 1e-154 senescence-related gene 1 (.1) Potri.001G381700 [exp] 50 / 6e-09 AT1G17020 436 / 2e-153 senescence-related gene 1 (.1) Potri.009G022800 [exp] 50 / 1e-08 AT1G17020 302 / 6e-101 senescence-related gene 1 (.1) Potri.001G382400 [exp] 49 / 2e-08 AT1G17020 446 / 1e-157 senescence-related gene 1 (.1) Potri.010G201000 [exp] 48 / 5e-08 AT3G21420 290 / 5e-96 LATERAL BRANCHING OXIDOREDUCTASE 1, 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Potri.010G200900 [exp] 46 / 1e-07 AT3G21420 288 / 4e-95 LATERAL BRANCHING OXIDOREDUCTASE 1, 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Potri.010G023550 [exp] 44 / 4e-07 AT3G21420 210 / 6e-68 LATERAL BRANCHING OXIDOREDUCTASE 1, 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Potri.010G023600 [exp] 45 / 6e-07 AT3G21420 511 / 0.0 LATERAL BRANCHING OXIDOREDUCTASE 1, 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Potri.009G025900 [exp] 44 / 1e-06 AT4G25300 410 / 3e-143 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2) Potri.018G121800 [exp] 36 / 0.0006 AT5G54000 407 / 2e-142 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10040106 pacid=23173914 polypeptide=Lus10040106 locus=Lus10040106.g ID=Lus10040106.BGIv1.0 annot-version=v1.0 ATGAAGGTGGATCAGCCGTTGCAGGAGAAGATGTCATGTGCCCGGTTGCCAAACAACATCGAAGGATACAGCCAGGCGTTTGTGGTATCGGAAGAACAGA AGCTTGATTGGGGTGACATAGGTTTTGGCCAACGGTTCCCTTTTCTTTCAGGACTAGTTCTGTACAATACTCATCTGAGCTGGAAAAACTGGCATGGAGT CTGA
AA sequence Show only first row Show all	>Lus10040106 pacid=23173914 polypeptide=Lus10040106 locus=Lus10040106.g ID=Lus10040106.BGIv1.0 annot-version=v1.0 MKVDQPLQEKMSCARLPNNIEGYSQAFVVSEEQKLDWGDIGFGQRFPFLSGLVLYNTHLSWKNWHGV

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G25300			2-oxoglutarate (2OG) and Fe(II...		Lus10040106 [exp]	0	1
AT1G18010			Major facilitator superfamily ...		Lus10043370 [exp]	2.8	0.8508
AT5G53110			RING/U-box superfamily protein...		Lus10025491 [exp]	4.2	0.8308
AT5G23260	MADS	ABS, TT16, AGL3...	TRANSPARENT TESTA16, AGAMOUS-l...		Lus10017388 [exp]	4.9	0.8138
AT2G31100			alpha/beta-Hydrolases superfam...		Lus10000983 [exp]	7.1	0.7533
AT4G16480		ATINT4	inositol transporter 4 (.1)		Lus10038808 [exp]	7.9	0.7615
AT3G13860		HSP60-3A	heat shock protein 60-3A (.1)		Lus10003791 [exp]	9.9	0.7800
AT3G19508			unknown protein		Lus10013875 [exp]	11.0	0.7586
AT1G69800			Cystathionine beta-synthase (C...		Lus10030788 [exp]	11.2	0.8085
					Lus10014515 [exp]	11.6	0.8210
AT1G69800			Cystathionine beta-synthase (C...		Lus10013265 [exp]	15.2	0.7987

Compare expression of checked genes

Lus10040106 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.