Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G59840 115 / 4e-35 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10030936 [exp] 176 / 8e-59 AT3G59840 118 / 4e-36 unknown protein
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G146700 [exp] 142 / 1e-45 AT3G59840 111 / 2e-33 unknown protein
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10040110 pacid=23173937 polypeptide=Lus10040110 locus=Lus10040110.g ID=Lus10040110.BGIv1.0 annot-version=v1.0 ATGGGTCTACTCTCTTGGTTCAAAGGAAGCCCTCAATCCAACGAAGCATCCGGCGACGCCAGCCCCAAACCTGCGGCGGCGACAGAGATCGTAGGTATGA ACGGCGCGGTAGAGGTGCCGCCCCGTCCTCCTCCGAAGAACGTGACGGTTTTTGAGTTCGGGTCGGTGGGTAGTTCAACGGATAAGGTTACGCTGGCCGG TTTCTGCCCCGTCTCGGAGGACCTGGAGCCTTGCCGCTGGGAAATCCTTCCTTCTACTGACGCCGATGCACCTCAGTTCCGGGTTGTCTTCTAA
AA sequence Show only first row Show all	>Lus10040110 pacid=23173937 polypeptide=Lus10040110 locus=Lus10040110.g ID=Lus10040110.BGIv1.0 annot-version=v1.0 MGLLSWFKGSPQSNEASGDASPKPAAATEIVGMNGAVEVPPRPPPKNVTVFEFGSVGSSTDKVTLAGFCPVSEDLEPCRWEILPSTDADAPQFRVVF

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G59840			unknown protein		Lus10040110 [exp]	0	1
AT3G45970		ATHEXPBETA2.1, ...	EXPANSIN L1, expansin-like A1 ...		Lus10023968 [exp]	8.5	0.7724
AT1G66230	MYB	ATMYB20	myb domain protein 20 (.1)		Lus10002296 [exp]	18.1	0.7843
AT2G41010		ATCAMBP25	calmodulin (CAM)-binding prote...		Lus10016205 [exp]	21.1	0.7796
AT1G78080	AP2_ERF	CAF1, RAP2.4, W...	wound induced dedifferentiatio...		Lus10016801 [exp]	22.5	0.7758
AT5G60440	MADS	AGL62	AGAMOUS-like 62 (.1)		Lus10003940 [exp]	29.7	0.7525
AT5G48540			receptor-like protein kinase-r...		Lus10038227 [exp]	31.0	0.7710
AT5G16080		ATCXE17	carboxyesterase 17 (.1)		Lus10041632 [exp]	35.2	0.7544
AT5G47430			DWNN domain, a CCHC-type zinc ...		Lus10029205 [exp]	38.5	0.7247
AT2G33580			Protein kinase superfamily pro...		Lus10042225 [exp]	39.5	0.7518
AT5G16080		ATCXE17	carboxyesterase 17 (.1)		Lus10024087 [exp]	40.8	0.7586

Compare expression of checked genes

Lus10040110 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.