Lus10040119 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G46930 93 / 2e-22 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
AT5G46970 88 / 8e-21 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
AT5G46940 80 / 6e-18 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
AT5G46960 79 / 2e-17 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
AT5G46950 68 / 2e-13 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
AT5G38610 66 / 1e-12 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
AT5G46990 61 / 6e-11 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
AT5G46980 53 / 3e-08 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
AT1G54620 50 / 5e-07 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10030926 125 / 2e-35 AT5G46930 58 / 2e-11 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Lus10019498 113 / 6e-30 AT5G46970 87 / 1e-21 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Lus10043346 99 / 3e-25 AT5G46940 69 / 3e-15 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Lus10001464 45 / 2e-05 AT4G02250 112 / 1e-31 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Lus10008201 44 / 7e-05 AT4G02250 113 / 3e-32 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Lus10031483 40 / 0.0009 AT5G46940 64 / 8e-13 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.003G086500 141 / 2e-40 AT5G46940 119 / 6e-34 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Potri.014G044100 105 / 5e-27 AT5G46940 111 / 3e-31 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Potri.003G086600 94 / 7e-23 AT5G38610 123 / 2e-35 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Potri.010G209800 42 / 0.0001 AT5G64620 93 / 5e-24 cell wall / vacuolar inhibitor of fructosidase 2 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF04043 PMEI Plant invertase/pectin methylesterase inhibitor
Representative CDS sequence
>Lus10040119 pacid=23174170 polypeptide=Lus10040119 locus=Lus10040119.g ID=Lus10040119.BGIv1.0 annot-version=v1.0
ATGGTGTGGGCTAGGAAGGCGAAGAATGCTTCGCTTGTTATACGAAAGAATTGCATGGTAGGCAGAAGTTTGTTCCTTCTTTTTGTTGGACAAACAAGTA
AACAACTTTCGGGATCATTTTTGTATCGACCCATCTTCCCAAAGATGCCGAAGAAATCACATCACTGCACAAACACAACGCATATGGGTGATGCTGTACT
TTCCTCATTCTCCCATTCCTCCATCCACACCCACCTTTCTCCATCATCAATCATTCATCTCCCCCAAGAATATACCAAGCTGTATAGTAAACTCGTAAAC
TTCTTTTGTAGAGAGGCCCCCCTATATAAATTATCAAGCGCTCATCAGCATCTAGAACAGACCAAAATCACACCCATATCGAACACAACCAAGACGATGA
AACTTCAAACATTACTAATTACTCTCACAGTACTAACGACGGCTCTGCTAATTTCCTCCTCATCAATGGCGTGTACCAATAACTTCGTTCGCCGTCACTG
TAAAGAAGCAGCAAACTCGGATCCCAACTTCACCTACAACTTCTGCGTCCAATGCATCGAGGATGATGATACCATCACCAACATCCACAACGTGACTACC
CTTGAGCAGCTGGTGGGCCTCACGATCAATCTCACGGTCGTTAACGCCACAAACATCAAAGGCCGGATCTCCCAGTTACTGTCAGCCCCAAGGACGAGGA
CGAGGAGCATGGATGGTTACCAGAAGCGCGCTCTACAGGATTGCTTGGAGCTTTACTCTGACGCGAAAGCGGCCTTGATAGACGCAAAGAAGGATGTGCT
GGAGTACGGTGACTACTACAAGGCGAATGTCGAGGCCAGCGCGGCCATGGATTCGTCGGTTACGTGTGAGGATGGGTTTAGTGATGAGAAGAGAGGCGTG
GTTTCTCCTTTGAGCAAGGAGAACGCGGTGTTCTTCCGGTTGACTGCCATTGTTCTTTCTTTCATTAATATGTTGCGTAATTAG
AA sequence
>Lus10040119 pacid=23174170 polypeptide=Lus10040119 locus=Lus10040119.g ID=Lus10040119.BGIv1.0 annot-version=v1.0
MVWARKAKNASLVIRKNCMVGRSLFLLFVGQTSKQLSGSFLYRPIFPKMPKKSHHCTNTTHMGDAVLSSFSHSSIHTHLSPSSIIHLPQEYTKLYSKLVN
FFCREAPLYKLSSAHQHLEQTKITPISNTTKTMKLQTLLITLTVLTTALLISSSSMACTNNFVRRHCKEAANSDPNFTYNFCVQCIEDDDTITNIHNVTT
LEQLVGLTINLTVVNATNIKGRISQLLSAPRTRTRSMDGYQKRALQDCLELYSDAKAALIDAKKDVLEYGDYYKANVEASAAMDSSVTCEDGFSDEKRGV
VSPLSKENAVFFRLTAIVLSFINMLRN

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G46930 Plant invertase/pectin methyle... Lus10040119 0 1
AT5G13870 EXGT-A4, XTH5, ... endoxyloglucan transferase A4,... Lus10030923 13.2 0.9536
AT4G24510 VC2, VC-2, CER2 ECERIFERUM 2, HXXXD-type acyl-... Lus10028171 17.3 0.9379
AT1G18400 bHLH bHLH044, BEE1 BR enhanced expression 1 (.1) Lus10017602 19.1 0.9395
AT1G70250 receptor serine/threonine kina... Lus10032228 19.6 0.8818
AT3G50330 bHLH HEC2, bHLH037 HECATE 2, basic helix-loop-hel... Lus10012670 21.6 0.9322
AT1G18400 bHLH bHLH044, BEE1 BR enhanced expression 1 (.1) Lus10033562 29.9 0.9324
AT4G34760 SAUR-like auxin-responsive pro... Lus10028466 36.6 0.9318
AT5G04190 PKS4 phytochrome kinase substrate 4... Lus10040995 38.1 0.9316
AT1G03790 C3HZnF SOM SOMNUS, Zinc finger C-x8-C-x5-... Lus10017708 38.2 0.9188
AT3G12880 Plant invertase/pectin methyle... Lus10031197 43.5 0.9276

Lus10040119 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.