Lus10040121 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G13870 493 / 5e-178 EXGT-A4, XTH5, XTR12 endoxyloglucan transferase A4, xyloglucan endotransglucosylase/hydrolase 5 (.1)
AT2G06850 478 / 2e-172 XTH4, EXT, EXGT-A1 endoxyloglucan transferase A1, xyloglucan endotransglucosylase/hydrolase 4 (.1)
AT3G23730 315 / 1e-107 XTH16 xyloglucan endotransglucosylase/hydrolase 16 (.1)
AT5G65730 311 / 3e-106 XTH6, XTR10 xyloglucan endotransglucosylase/hydrolase 6 (.1)
AT4G14130 309 / 2e-105 XTR7, XTH15 xyloglucan endotransglycosylase 7, xyloglucan endotransglucosylase/hydrolase 15 (.1)
AT4G03210 308 / 5e-105 XTH9, EXGT-A6, XTR16 xyloglucan endotransglucosylase/hydrolase 9 (.1.2)
AT5G57550 295 / 3e-100 XTR3, XTH25, EXGT-A5 xyloglucan endotransglycosylase 3, xyloglucan endotransglucosylase/hydrolase 25 (.1)
AT4G37800 295 / 6e-100 XTH7, XTR15 xyloglucan endotransglucosylase/hydrolase 7 (.1)
AT5G57560 290 / 3e-98 XTH22, TCH4 xyloglucan endotransglucosylase/hydrolase 22, Touch 4, Xyloglucan endotransglucosylase/hydrolase family protein (.1)
AT1G11545 288 / 3e-97 XTH8 xyloglucan endotransglucosylase/hydrolase 8 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10030923 609 / 0 AT5G13870 491 / 3e-177 endoxyloglucan transferase A4, xyloglucan endotransglucosylase/hydrolase 5 (.1)
Lus10011052 528 / 0 AT5G13870 507 / 0.0 endoxyloglucan transferase A4, xyloglucan endotransglucosylase/hydrolase 5 (.1)
Lus10003022 528 / 0 AT5G13870 506 / 0.0 endoxyloglucan transferase A4, xyloglucan endotransglucosylase/hydrolase 5 (.1)
Lus10039715 325 / 1e-111 AT4G03210 441 / 1e-157 xyloglucan endotransglucosylase/hydrolase 9 (.1.2)
Lus10018503 321 / 5e-110 AT4G03210 439 / 9e-157 xyloglucan endotransglucosylase/hydrolase 9 (.1.2)
Lus10010938 308 / 4e-105 AT4G14130 386 / 3e-136 xyloglucan endotransglycosylase 7, xyloglucan endotransglucosylase/hydrolase 15 (.1)
Lus10031586 308 / 7e-105 AT4G03210 446 / 9e-160 xyloglucan endotransglucosylase/hydrolase 9 (.1.2)
Lus10011597 306 / 4e-104 AT5G65730 469 / 7e-169 xyloglucan endotransglucosylase/hydrolase 6 (.1)
Lus10039643 305 / 8e-104 AT5G65730 469 / 1e-168 xyloglucan endotransglucosylase/hydrolase 6 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.001G071000 524 / 0 AT5G13870 504 / 0.0 endoxyloglucan transferase A4, xyloglucan endotransglucosylase/hydrolase 5 (.1)
Potri.003G159700 523 / 0 AT5G13870 500 / 0.0 endoxyloglucan transferase A4, xyloglucan endotransglucosylase/hydrolase 5 (.1)
Potri.014G140300 496 / 3e-179 AT5G13870 527 / 0.0 endoxyloglucan transferase A4, xyloglucan endotransglucosylase/hydrolase 5 (.1)
Potri.002G060500 315 / 7e-108 AT4G14130 424 / 3e-151 xyloglucan endotransglycosylase 7, xyloglucan endotransglucosylase/hydrolase 15 (.1)
Potri.002G060400 313 / 2e-107 AT4G14130 402 / 2e-142 xyloglucan endotransglycosylase 7, xyloglucan endotransglucosylase/hydrolase 15 (.1)
Potri.005G201200 313 / 3e-107 AT4G14130 405 / 2e-143 xyloglucan endotransglycosylase 7, xyloglucan endotransglucosylase/hydrolase 15 (.1)
Potri.007G008500 312 / 8e-107 AT5G65730 472 / 6e-170 xyloglucan endotransglucosylase/hydrolase 6 (.1)
Potri.005G201250 311 / 2e-106 AT4G14130 395 / 2e-139 xyloglucan endotransglycosylase 7, xyloglucan endotransglucosylase/hydrolase 15 (.1)
Potri.014G146100 306 / 2e-104 AT3G23730 451 / 1e-161 xyloglucan endotransglucosylase/hydrolase 16 (.1)
Potri.002G236200 305 / 5e-104 AT3G23730 436 / 1e-155 xyloglucan endotransglucosylase/hydrolase 16 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0004 Concanavalin PF00722 Glyco_hydro_16 Glycosyl hydrolases family 16
CL0004 Concanavalin PF06955 XET_C Xyloglucan endo-transglycosylase (XET) C-terminus
Representative CDS sequence
>Lus10040121 pacid=23173910 polypeptide=Lus10040121 locus=Lus10040121.g ID=Lus10040121.BGIv1.0 annot-version=v1.0
ATGGCTACGAGGAACATGGTGCCTCTGGTGCTGATGATTGCCATGCTGCTTTGTGGAACAACAATGGCGCTTGCCCCAAGGAAACCAGTCCCAGTCCCAT
TCGGCAGGAACTACGCCCCTACTTGGGCTTTCGACCACATCAAGTACTTCAACGGCGGCTCCGAGATTCAGCTCCACTTGGACAAATACACCGGGACTGG
ATTCCAATCAAAAGGGTCATACTTGTTCGGACACTTCAGTATGCAGATGAAGTTGGTCCCCGGAGATTCTGCCGGAACCGTTACTGCTTTCTACCTATCA
TCGCAAAACTCGGAGCATGACGAGATAGATTTCGAGTTCTTGGGGAACAGAACAGGGCAGCCTTACATTCTACAAACAAACGTGTTCACCGGCGGGAAAG
GTGACAGGGAACAGAGGATATACCTCTGGTTTGACCCAACCAAAGCTTACCATTCCTACTCCGTCCTCTGGACCTCCAACATCATTGCGTTCTTTGTGGA
CGATGTGCCAATCAGAGTGTTTAAGAATCTCAAGAACTTGGGAGTGAAGTTCCCATTCGAGCAGCCGATGAAGATATACTCCAGCCTATGGAACGCCGAC
GACTGGGCCACCAGGGGAGGTTTGGAGAAGACCGATTGGTCCAAGGCTCCGTTCATCGCGTCCTACAGGGAGTTCCACGTGGACGGCTGCGAGGCGTCGG
TGCAGGCTAAGTTCTGTGCGACCCAGGGGAAGAGATGGTGGGACCAGAAGGAGTTCCAGGACCTTGACGCTTATCAGTACCGTAGGCTGAAGTGGGTCCG
CCAGAGGTTCACCATTTACAACTACTGTACCGACCGGGTCCGGTACCCTTTGCTGCCCGCCGAGTGCAGACCTGACCGTGATATTTAA
AA sequence
>Lus10040121 pacid=23173910 polypeptide=Lus10040121 locus=Lus10040121.g ID=Lus10040121.BGIv1.0 annot-version=v1.0
MATRNMVPLVLMIAMLLCGTTMALAPRKPVPVPFGRNYAPTWAFDHIKYFNGGSEIQLHLDKYTGTGFQSKGSYLFGHFSMQMKLVPGDSAGTVTAFYLS
SQNSEHDEIDFEFLGNRTGQPYILQTNVFTGGKGDREQRIYLWFDPTKAYHSYSVLWTSNIIAFFVDDVPIRVFKNLKNLGVKFPFEQPMKIYSSLWNAD
DWATRGGLEKTDWSKAPFIASYREFHVDGCEASVQAKFCATQGKRWWDQKEFQDLDAYQYRRLKWVRQRFTIYNYCTDRVRYPLLPAECRPDRDI

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G13870 EXGT-A4, XTH5, ... endoxyloglucan transferase A4,... Lus10040121 0 1
AT1G29640 Protein of unknown function, D... Lus10011993 3.7 0.7988
AT5G15240 Transmembrane amino acid trans... Lus10030683 10.7 0.7935
AT4G25680 PPPDE putative thiol peptidase... Lus10014960 17.9 0.7912
AT5G16790 AtTHO7 Tho complex subunit 7/Mft1p (.... Lus10030532 24.5 0.7561
AT4G35470 PIRL4, DREB1C plant intracellular ras group-... Lus10004558 25.5 0.7874
Lus10041110 34.4 0.7930
AT1G78850 D-mannose binding lectin prote... Lus10000579 35.1 0.7837
AT1G69490 NAC NAP, ANAC029, A... Arabidopsis NAC domain contain... Lus10026617 43.0 0.7459
AT1G03610 Protein of unknown function (D... Lus10039803 82.7 0.7321
AT3G51770 ATEOL1, ETO1 ARABIDOPSIS ETHYLENE OVERPRODU... Lus10002206 109.7 0.6843

Lus10040121 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.