Lus10040124 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G66160 155 / 2e-45 ATCMPG1 "CYS, MET, PRO, and GLY protein 1", CYS, MET, PRO, and GLY protein 1 (.1.2)
AT5G37490 154 / 1e-44 ARM repeat superfamily protein (.1)
AT3G52450 135 / 1e-37 PUB22 plant U-box 22 (.1)
AT1G49780 134 / 2e-37 PUB26 plant U-box 26 (.1)
AT2G35930 133 / 4e-37 PUB23 plant U-box 23 (.1)
AT3G19380 131 / 3e-36 PUB25 plant U-box 25 (.1)
AT3G11840 110 / 2e-28 PUB24 plant U-box 24 (.1)
AT5G64660 96 / 2e-23 ATCMPG2 "CYS, MET, PRO, and GLY protein 2", CYS, MET, PRO, and GLY protein 2 (.1)
AT3G18710 95 / 6e-23 ATPUB29 ARABIDOPSIS THALIANA PLANT U-BOX 29, plant U-box 29 (.1)
AT3G46510 94 / 3e-22 ATPUB13 ARABIDOPSIS THALIANA PLANT U-BOX 13, plant U-box 13 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10001079 355 / 1e-122 AT5G37490 290 / 1e-93 ARM repeat superfamily protein (.1)
Lus10016166 130 / 1e-35 AT3G52450 462 / 2e-161 plant U-box 22 (.1)
Lus10021267 129 / 3e-35 AT2G35930 474 / 5e-167 plant U-box 23 (.1)
Lus10029393 128 / 4e-35 AT3G52450 462 / 1e-161 plant U-box 22 (.1)
Lus10013584 124 / 9e-34 AT2G35930 471 / 2e-165 plant U-box 23 (.1)
Lus10004189 116 / 2e-33 AT1G66160 75 / 7e-17 "CYS, MET, PRO, and GLY protein 1", CYS, MET, PRO, and GLY protein 1 (.1.2)
Lus10000800 122 / 7e-33 AT3G11840 293 / 7e-95 plant U-box 24 (.1)
Lus10008368 119 / 1e-31 AT3G11840 284 / 2e-91 plant U-box 24 (.1)
Lus10004191 108 / 4e-27 AT3G11840 300 / 2e-95 plant U-box 24 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.012G042600 212 / 3e-67 AT5G37490 294 / 2e-95 ARM repeat superfamily protein (.1)
Potri.015G031000 208 / 1e-65 AT5G37490 323 / 9e-107 ARM repeat superfamily protein (.1)
Potri.017G135000 184 / 2e-56 AT5G37490 375 / 4e-127 ARM repeat superfamily protein (.1)
Potri.004G083900 181 / 4e-55 AT5G37490 354 / 8e-119 ARM repeat superfamily protein (.1)
Potri.008G137700 174 / 1e-52 AT5G37490 333 / 9e-111 ARM repeat superfamily protein (.1)
Potri.010G103100 172 / 9e-52 AT5G37490 315 / 1e-103 ARM repeat superfamily protein (.1)
Potri.009G016200 145 / 8e-42 AT2G35930 475 / 4e-167 plant U-box 23 (.1)
Potri.009G100200 141 / 5e-40 AT1G49780 515 / 0.0 plant U-box 26 (.1)
Potri.004G140100 140 / 2e-39 AT1G49780 517 / 0.0 plant U-box 26 (.1)
Potri.016G069400 137 / 2e-38 AT3G52450 511 / 0.0 plant U-box 22 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0229 RING PF04564 U-box U-box domain
Representative CDS sequence
>Lus10040124 pacid=23173989 polypeptide=Lus10040124 locus=Lus10040124.g ID=Lus10040124.BGIv1.0 annot-version=v1.0
ATGGCGTTTTGGAGAAGGAAAAGGATCGCTGCCAATCTGGACAGCGACAGCAAGCACAAGAATCACTCAAGGATTAGCGGAAAGAAGAAGGATATAGAAT
CGCTTCATCAGGAAGAAGAGAAAGCTGTTGTGCTTCCGACCCATTTCCTCTGCCCGATATCTCTTGACCTGATGACCGATCCGGTCACATTGTCCTCCGG
CATCTCCTACGACCGTGACAGCATCGAGACCTGGCTTAAAGGCGGCAACTTCACTTGCCCAGTCACCAATCAGACACTCTTGACCTTCGACTTGGTACCC
AACCACTCCCTCCGCCGTATGATTCAAGACTGGTGCGTTCAGAACGGCAGATTCGGCGTCGAGAGAATCCCTACTCCCAGAGTCCCTGTTTCCTCCTCTC
AAATCTCCGCCGTCCTCCTCCGGTTGGAGGATTCCGCCGCGAGATTGAACGTGTCAGAGACCATGGACGCCTTGCATAAGATTAACAGCTGGGGAAACGA
GAGCGAGAGGAATCGATTGTGTATTGTCTCCGCCGGCCTGCTCCGCGCCCGCCCTCGCCGCCCCGTGCGACGGATTCGCCGGCGGCGAATCCGTCGGAGT
ACTGGAGCAGCTGCTAGCTTCGATTAG
AA sequence
>Lus10040124 pacid=23173989 polypeptide=Lus10040124 locus=Lus10040124.g ID=Lus10040124.BGIv1.0 annot-version=v1.0
MAFWRRKRIAANLDSDSKHKNHSRISGKKKDIESLHQEEEKAVVLPTHFLCPISLDLMTDPVTLSSGISYDRDSIETWLKGGNFTCPVTNQTLLTFDLVP
NHSLRRMIQDWCVQNGRFGVERIPTPRVPVSSSQISAVLLRLEDSAARLNVSETMDALHKINSWGNESERNRLCIVSAGLLRARPRRPVRRIRRRRIRRS
TGAAASFD

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G66160 ATCMPG1 "CYS, MET, PRO, and GLY protei... Lus10040124 0 1
AT5G42830 HXXXD-type acyl-transferase fa... Lus10024809 1.4 0.9961
AT3G02840 ARM repeat superfamily protein... Lus10040125 1.7 0.9962
AT3G05200 ATL6 RING/U-box superfamily protein... Lus10000333 1.7 0.9936
AT1G26910 RPL10B ribosomal protein L10 B, Ribos... Lus10034092 3.9 0.9923
AT2G20610 RTY1, RTY, HLS3... SUPERROOT 1, ROOTY 1, ROOTY, H... Lus10017703 4.0 0.9908
AT4G36810 GGPS1 geranylgeranyl pyrophosphate s... Lus10028509 4.2 0.9921
Lus10040445 4.2 0.9905
AT4G04450 WRKY ATWRKY42, WRKY4... WRKY family transcription fact... Lus10020023 5.7 0.9923
AT3G54200 Late embryogenesis abundant (L... Lus10032671 5.8 0.9846
AT4G06536 SPla/RYanodine receptor (SPRY)... Lus10018730 6.5 0.9862

Lus10040124 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.