Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G48440 161 / 3e-52 B-cell receptor-associated 31-like (.1) AT3G17780 158 / 4e-51 unknown protein AT5G17190 89 / 8e-24 unknown protein AT3G03160 89 / 1e-23 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10001080 [exp] 212 / 3e-72 AT1G48440 190 / 7e-64 B-cell receptor-associated 31-like (.1) Lus10034347 [exp] 86 / 3e-22 AT5G17190 246 / 5e-86 unknown protein Lus10005110 [exp] 84 / 1e-21 AT5G17190 244 / 6e-85 unknown protein Lus10031957 [exp] 0 / 1 AT5G17190 159 / 3e-51 unknown protein
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.015G030801 [exp] 177 / 1e-58 AT1G48440 184 / 4e-61 B-cell receptor-associated 31-like (.1) Potri.012G042700 [exp] 177 / 1e-58 AT1G48440 172 / 2e-56 B-cell receptor-associated 31-like (.1) Potri.008G133600 [exp] 84 / 1e-21 AT5G17190 244 / 7e-85 unknown protein Potri.010G108000 [exp] 82 / 5e-21 AT5G17190 245 / 1e-85 unknown protein Potri.015G035400 [exp] 72 / 3e-17 AT3G03160 142 / 1e-44 unknown protein
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF05529 [flax] [poplar] Bap31 Bap31/Bap29 transmembrane region
Representative CDS sequence Show only first row Show all	>Lus10040126 pacid=23173825 polypeptide=Lus10040126 locus=Lus10040126.g ID=Lus10040126.BGIv1.0 annot-version=v1.0 ATGGCGTTGCAGTGGATGATTCTGGCTTACGTGGTTGCGGCAGAGGTGGCCCTCGTCGTGCTGCTGACAGCTCCCGCCCCGAAGCTGATCAAGAATCAGC TGGTTTCCCTAATTTCTCTCATACTCCAGCCGGCGCTCTTCATCGTGCCGTTTGCCGGATTCCAGCTCCTCGATATATATTGGAAGAATGAGCATCGCTT GCAGTGCACATCCGACATCTGTACCGCCGCTGAGCGGGATCGTTACGAAAAATCTATGTACAAATCGCAGAGGAATGTGGTCCTATGTGCTGCAGCCTGT ATTTTGTACTGGTGTATGTATCGTATAGCACAGTACCACAAAGAGATCCAGAAGTTGGAGGAAGTGGAGAAGAGGTACAAGGAGGAGTAA
AA sequence Show only first row Show all	>Lus10040126 pacid=23173825 polypeptide=Lus10040126 locus=Lus10040126.g ID=Lus10040126.BGIv1.0 annot-version=v1.0 MALQWMILAYVVAAEVALVVLLTAPAPKLIKNQLVSLISLILQPALFIVPFAGFQLLDIYWKNEHRLQCTSDICTAAERDRYEKSMYKSQRNVVLCAAAC ILYWCMYRIAQYHKEIQKLEEVEKRYKEE

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G48440			B-cell receptor-associated 31-...		Lus10040126 [exp]	0	1
AT1G48440			B-cell receptor-associated 31-...		Lus10001080 [exp]	1.0	0.9470
AT4G00585			unknown protein		Lus10007571 [exp]	3.2	0.8503
AT3G59380		FTA, PLP, ATFTA...	PLURIPETALA, farnesyltransfera...		Lus10015954 [exp]	3.5	0.8434
AT1G52600			Peptidase S24/S26A/S26B/S26C f...		Lus10030080 [exp]	3.5	0.8314
AT3G22845			emp24/gp25L/p24 family/GOLD fa...		Lus10041182 [exp]	3.5	0.8211
AT2G02050			NADH-ubiquinone oxidoreductase...		Lus10035094 [exp]	4.5	0.8261
AT4G34700		CIB22, AtCIB22	B22 subunit of eukaryotic mito...		Lus10031084 [exp]	5.3	0.8111
AT3G10860			Cytochrome b-c1 complex, subun...		Lus10034442 [exp]	7.7	0.7944
AT3G07680			emp24/gp25L/p24 family/GOLD fa...		Lus10016624 [exp]	10.0	0.7983
AT2G36690			2-oxoglutarate (2OG) and Fe(II...		Lus10001711 [exp]	10.2	0.7849

Compare expression of checked genes

Lus10040126 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.