Lus10040143 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10007175 52 / 7e-09 AT5G27260 67 / 2e-12 unknown protein
Lus10007133 45 / 2e-06 AT5G27260 46 / 8e-06 unknown protein
Lus10004902 42 / 9e-06 ND 36 / 0.002
Poplar homologues

No hit found

PFAM info
Representative CDS sequence
>Lus10040143 pacid=23174199 polypeptide=Lus10040143 locus=Lus10040143.g ID=Lus10040143.BGIv1.0 annot-version=v1.0
ATGACGATTTTGCAGTTGTCAATCGAAGCTTCCCTGTTTTCGATCTCTGAGTGGGATTTCGCGACGGCGTCTCGCAGCTTTCAATCGGGAGCTTCTGGTT
CTTGTCTCTTAGTGGGATTTCACGGCGGTGGATTCATCTGTGGTCGAAAGACAGGTGGTTCGAAATCGTTGAATTTGGATGATTCTGTGGCCTACCAATT
ATGTGAGAGTCAAAATGGCTGGGGATGGGATGATCTGAGAAAATGTCCAGTTGTTGAACCTGAAATATTTGTACCCTTTGCAAAGGCTATTGACGTTGGT
GCCGTTCTCTCTCGTGATGAGAATGCTAGAGATCTGTAG
AA sequence
>Lus10040143 pacid=23174199 polypeptide=Lus10040143 locus=Lus10040143.g ID=Lus10040143.BGIv1.0 annot-version=v1.0
MTILQLSIEASLFSISEWDFATASRSFQSGASGSCLLVGFHGGGFICGRKTGGSKSLNLDDSVAYQLCESQNGWGWDDLRKCPVVEPEIFVPFAKAIDVG
AVLSRDENARDL

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
Lus10040143 0 1
Lus10001472 1.0 0.9256
AT1G76140 Prolyl oligopeptidase family p... Lus10021834 6.2 0.7427
AT5G10520 RBK1 ROP binding protein kinases 1 ... Lus10002659 9.9 0.8509
AT2G45650 MADS AGL6 AGAMOUS-like 6 (.1) Lus10015017 12.6 0.8499
AT5G41020 MYB myb family transcription facto... Lus10022932 16.0 0.8476
Lus10018114 17.7 0.7660
Lus10010783 19.6 0.7951
Lus10004634 22.1 0.8492
AT2G16730 BGAL13 beta-galactosidase 13, glycosy... Lus10019783 27.7 0.8457
AT4G29035 Plant self-incompatibility pro... Lus10022825 29.8 0.8163

Lus10040143 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.