Lus10040145 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10000961 335 / 4e-119 ND 39 / 5e-04
Lus10011019 137 / 2e-37 AT4G17610 1595 / 0.0 tRNA/rRNA methyltransferase (SpoU) family protein (.1)
Lus10007598 118 / 3e-33 ND 42 / 2e-04
Lus10027768 107 / 2e-29 ND /
Lus10035527 107 / 3e-29 AT4G24640 40 / 4e-04 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Lus10000822 46 / 4e-06 AT1G47960 113 / 1e-31 cell wall / vacuolar inhibitor of fructosidase 1 (.1)
Lus10016318 43 / 3e-05 AT1G47960 115 / 2e-32 cell wall / vacuolar inhibitor of fructosidase 1 (.1)
Lus10016317 42 / 5e-05 AT1G47960 115 / 2e-32 cell wall / vacuolar inhibitor of fructosidase 1 (.1)
Lus10002738 40 / 0.0002 AT1G47960 67 / 5e-14 cell wall / vacuolar inhibitor of fructosidase 1 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.013G012800 87 / 8e-22 ND /
Potri.005G195200 84 / 2e-20 AT5G64620 42 / 7e-05 cell wall / vacuolar inhibitor of fructosidase 2 (.1)
Potri.005G022200 82 / 6e-20 ND /
Potri.013G012733 82 / 7e-20 ND /
Potri.005G022250 74 / 1e-16 ND /
Potri.013G012766 74 / 1e-16 ND /
Potri.005G022300 74 / 2e-16 ND /
Potri.005G022400 73 / 4e-16 ND /
Potri.001G073350 59 / 6e-11 ND /
Potri.002G191500 51 / 4e-08 AT2G31430 104 / 2e-28 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF04043 PMEI Plant invertase/pectin methylesterase inhibitor
Representative CDS sequence
>Lus10040145 pacid=23173939 polypeptide=Lus10040145 locus=Lus10040145.g ID=Lus10040145.BGIv1.0 annot-version=v1.0
ATGGCTCCCAAGATCGTGCATCTTCTTCCCTTGGCAGCCCTAATCTTAATCCTCTGCCTCCCATCCCAAACCGAATCACACTCGCCGTCGTCCATCTCCG
ACTTCCACAAATCCGTCTGCCAGAAGAGCAACGACTACGCAGGGTGCATGAGGACCCTGAGATTGGACCCCAGGCTGGCCGCCGCCGGCGACATTAACAC
CCTGGCGAAGGTGGCGATGGACAAGGCGCAGAGGAAGTCGATGACGCTGAGCGACAGGTTTGCGAAGATGGAGAACGAGAACCCCGATCCGAAGGTGAAG
GAAGCGCTGAAGATGTGCGCGTTCGATTTCAAGGACGCGAAGATCTTCTTCAACCCTAGGTTGCTTGGGGATCCGACGGGGAGCTTGGATATTCATTCGG
CGTTGGACAATTGGCAGAACTGCAAGACTTTGATGGAGCAGAATCCGGATCTGCAGAAGATGGCTCCTGCGCTGAGGAAGTGGAAGCACCTGTATGCGAT
TGCGAATGGGGCGGTTGTTTACGCCGAAGATGAATCTGGCGGTGGTGGCGGTGGGGATTACCCTTAA
AA sequence
>Lus10040145 pacid=23173939 polypeptide=Lus10040145 locus=Lus10040145.g ID=Lus10040145.BGIv1.0 annot-version=v1.0
MAPKIVHLLPLAALILILCLPSQTESHSPSSISDFHKSVCQKSNDYAGCMRTLRLDPRLAAAGDINTLAKVAMDKAQRKSMTLSDRFAKMENENPDPKVK
EALKMCAFDFKDAKIFFNPRLLGDPTGSLDIHSALDNWQNCKTLMEQNPDLQKMAPALRKWKHLYAIANGAVVYAEDESGGGGGGDYP

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
Lus10040145 0 1
AT5G43260 chaperone protein dnaJ-related... Lus10037022 6.5 0.8498
AT1G61930 Protein of unknown function, D... Lus10020047 9.2 0.8592
AT1G61600 Protein of unknown function (D... Lus10035372 10.0 0.8384
AT5G16380 Protein of unknown function, D... Lus10020218 17.6 0.7386
AT4G22240 Plastid-lipid associated prote... Lus10014790 17.9 0.8282
AT3G53810 Concanavalin A-like lectin pro... Lus10016507 18.2 0.8240
AT5G57040 Lactoylglutathione lyase / gly... Lus10021574 19.2 0.8380
AT5G59730 ATEXO70H7 exocyst subunit exo70 family p... Lus10040872 21.4 0.8272
AT3G09032 unknown protein Lus10027777 22.5 0.8066
AT5G17170 ENH1 enhancer of sos3-1, rubredoxin... Lus10003157 23.7 0.8436

Lus10040145 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.