Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.011G016400 [exp] 40 / 6e-05 AT3G54070 110 / 8e-25 Ankyrin repeat family protein (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10040159 pacid=23174172 polypeptide=Lus10040159 locus=Lus10040159.g ID=Lus10040159.BGIv1.0 annot-version=v1.0 ATGTCAAAAGAAAAATCCGCTGCACCATCACCGGACGGAATCATTTTCAATCGGGCTCCCTTGTTCGATGGATCCAATTATGGATTCTGGAAGAGCCGGA TGAAAGCATTCCTTGAAGGGATCGATTTTGAATTATGGGATGTAGTGAAGGATTCGCTTCCAGAGGTCAAATTGAAACGGGAAAACTGGACAACCGCTGA GAAGAAGGTTAGGCAAATGAACGCTAAAGCTATCAACATCTTCTACAGTTCTGTGAGTGAAAACGAATTCGTCGAGTAA
AA sequence Show only first row Show all	>Lus10040159 pacid=23174172 polypeptide=Lus10040159 locus=Lus10040159.g ID=Lus10040159.BGIv1.0 annot-version=v1.0 MSKEKSAAPSPDGIIFNRAPLFDGSNYGFWKSRMKAFLEGIDFELWDVVKDSLPEVKLKRENWTTAEKKVRQMNAKAINIFYSSVSENEFVE

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10040159 [exp]	0	1
AT4G37330		CYP81D4	"cytochrome P450, family 81, s...		Lus10024817 [exp]	4.1	0.8867
AT2G23600		ATMES2, ACL, AT...	ARABIDOPSIS THALIANA METHYL ES...		Lus10012854 [exp]	5.8	0.8867
AT3G04720		HEL, PR-4, PR4	HEVEIN-LIKE, pathogenesis-rela...		Lus10013728 [exp]	7.1	0.8867
					Lus10026928 [exp]	8.2	0.8867
AT2G46150			Late embryogenesis abundant (L...		Lus10027177 [exp]	9.2	0.8867
AT3G15570			Phototropic-responsive NPH3 fa...		Lus10030390 [exp]	9.5	0.8494
					Lus10035046 [exp]	11.3	0.8726
AT2G37240			Thioredoxin superfamily protei...		Lus10030907 [exp]	11.5	0.8817
AT3G07680			emp24/gp25L/p24 family/GOLD fa...		Lus10006360 [exp]	11.8	0.8733
AT3G24140	bHLH	bHLH097, FMA	FAMA, basic helix-loop-helix (...		Lus10007139 [exp]	12.4	0.8618

Compare expression of checked genes

Lus10040159 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.