Lus10040161 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G08180 199 / 2e-66 Ribosomal protein L7Ae/L30e/S12e/Gadd45 family protein (.1.2)
AT4G12600 44 / 3e-06 Ribosomal protein L7Ae/L30e/S12e/Gadd45 family protein (.1.2)
AT2G47610 45 / 4e-06 Ribosomal protein L7Ae/L30e/S12e/Gadd45 family protein (.1)
AT5G20160 44 / 7e-06 Ribosomal protein L7Ae/L30e/S12e/Gadd45 family protein (.1.2.3)
AT4G22380 44 / 7e-06 Ribosomal protein L7Ae/L30e/S12e/Gadd45 family protein (.1)
AT3G62870 41 / 0.0001 Ribosomal protein L7Ae/L30e/S12e/Gadd45 family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10004366 278 / 1e-97 AT5G08180 227 / 1e-77 Ribosomal protein L7Ae/L30e/S12e/Gadd45 family protein (.1.2)
Lus10000421 242 / 3e-83 AT5G08180 240 / 9e-83 Ribosomal protein L7Ae/L30e/S12e/Gadd45 family protein (.1.2)
Lus10010993 231 / 3e-79 AT5G08180 229 / 3e-78 Ribosomal protein L7Ae/L30e/S12e/Gadd45 family protein (.1.2)
Lus10017031 46 / 7e-07 AT4G22380 220 / 2e-75 Ribosomal protein L7Ae/L30e/S12e/Gadd45 family protein (.1)
Lus10019420 47 / 1e-06 AT5G55190 443 / 8e-159 RAN GTPase 3 (.1)
Lus10043276 47 / 1e-06 AT5G55190 428 / 9e-153 RAN GTPase 3 (.1)
Lus10015295 44 / 2e-05 AT4G22380 217 / 7e-72 Ribosomal protein L7Ae/L30e/S12e/Gadd45 family protein (.1)
Lus10025435 43 / 4e-05 AT4G22380 203 / 7e-66 Ribosomal protein L7Ae/L30e/S12e/Gadd45 family protein (.1)
Lus10012463 42 / 6e-05 AT3G62870 457 / 2e-165 Ribosomal protein L7Ae/L30e/S12e/Gadd45 family protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.008G110100 223 / 1e-75 AT5G08180 225 / 8e-77 Ribosomal protein L7Ae/L30e/S12e/Gadd45 family protein (.1.2)
Potri.019G087100 49 / 7e-08 AT4G12600 213 / 9e-73 Ribosomal protein L7Ae/L30e/S12e/Gadd45 family protein (.1.2)
Potri.013G116800 47 / 5e-07 AT4G12600 216 / 3e-74 Ribosomal protein L7Ae/L30e/S12e/Gadd45 family protein (.1.2)
Potri.004G113800 42 / 5e-05 AT3G62870 399 / 5e-142 Ribosomal protein L7Ae/L30e/S12e/Gadd45 family protein (.1)
Potri.017G100800 42 / 6e-05 AT3G62870 377 / 1e-133 Ribosomal protein L7Ae/L30e/S12e/Gadd45 family protein (.1)
Potri.017G101000 42 / 6e-05 AT3G62870 376 / 3e-133 Ribosomal protein L7Ae/L30e/S12e/Gadd45 family protein (.1)
Potri.004G113900 41 / 0.0002 AT3G62870 362 / 7e-127 Ribosomal protein L7Ae/L30e/S12e/Gadd45 family protein (.1)
Potri.001G326400 40 / 0.0002 AT2G47610 385 / 1e-136 Ribosomal protein L7Ae/L30e/S12e/Gadd45 family protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0101 PELOTA PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Representative CDS sequence
>Lus10040161 pacid=23173896 polypeptide=Lus10040161 locus=Lus10040161.g ID=Lus10040161.BGIv1.0 annot-version=v1.0
ATGGGCAGCGACGGCGAAGGCGAAAAATCGCAGAAGCGGGAGGAGAAGACGAAAAAGGCGATAACTCTTGCTCCAATTGCCAAGCCCCTCGCTGGGAAGA
AGCTCTCCAAGAAAACTTTCAAGCTCGTCAAGAGAGCTGCTGAACATAAGTGCTTGAAACGAGGAGTGAAGGAGGTAGTTAAGAGCATTCGACGTGGTCA
TAAAGGGATATGCATTATTGCTGGGAACATATCTCCAATTGATGTTATTACTCATGTTCCAATCTTGTGTGAAGAGGCTGAAATCCCATACTTTTATGTT
TCTTCAAAAGAAGATCTTGCTACCGCAGGAAACACAAAGAGGCCTACTTGCTGTGTTCTGGTTCAAACTAAACCCCCCAAGGGAGAGATACCTAAGGAGG
AGCAAGAGAAGTTGCAGTCAGATTATGATCAAGTTGTAGCTGATGTCTCTGAACTCACCACCTCTCTATTCTGA
AA sequence
>Lus10040161 pacid=23173896 polypeptide=Lus10040161 locus=Lus10040161.g ID=Lus10040161.BGIv1.0 annot-version=v1.0
MGSDGEGEKSQKREEKTKKAITLAPIAKPLAGKKLSKKTFKLVKRAAEHKCLKRGVKEVVKSIRRGHKGICIIAGNISPIDVITHVPILCEEAEIPYFYV
SSKEDLATAGNTKRPTCCVLVQTKPPKGEIPKEEQEKLQSDYDQVVADVSELTTSLF

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G08180 Ribosomal protein L7Ae/L30e/S1... Lus10040161 0 1
AT5G08180 Ribosomal protein L7Ae/L30e/S1... Lus10004366 1.0 0.9589
AT3G20260 Protein of unknown function (D... Lus10034809 4.0 0.9241
AT3G48710 DEK domain-containing chromati... Lus10016746 6.3 0.8958
AT1G51060 HTA10 histone H2A 10 (.1) Lus10032464 6.3 0.9177
AT3G53730 Histone superfamily protein (.... Lus10023331 7.1 0.9203
AT3G53730 Histone superfamily protein (.... Lus10005896 8.4 0.9024
AT3G44750 HDT1, HDA3, ATH... HISTONE DEACETYLASE 2A, histon... Lus10003376 8.4 0.8619
AT3G02680 ATNBS1, NBS1 nijmegen breakage syndrome 1 (... Lus10007365 10.1 0.8623
AT1G20580 Small nuclear ribonucleoprotei... Lus10013227 10.4 0.8721
AT1G12340 Cornichon family protein (.1) Lus10004023 10.8 0.8122

Lus10040161 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.