Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10020690 [exp] 92 / 8e-23 AT3G62630 232 / 1e-72 Protein of unknown function (DUF1645) (.1) Lus10029855 [exp] 78 / 1e-17 AT3G62630 236 / 2e-74 Protein of unknown function (DUF1645) (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.013G010400 [exp] 65 / 4e-13 AT3G62630 199 / 7e-60 Protein of unknown function (DUF1645) (.1) Potri.005G019600 [exp] 64 / 1e-12 AT3G62630 218 / 5e-67 Protein of unknown function (DUF1645) (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF07816 [flax] [poplar] DUF1645 Protein of unknown function (DUF1645)
Representative CDS sequence Show only first row Show all	>Lus10040164 pacid=23174118 polypeptide=Lus10040164 locus=Lus10040164.g ID=Lus10040164.BGIv1.0 annot-version=v1.0 ATGATGAAGAGGAATGAAGAAAAGACACACTGCAGCTCATATACTTATTCGCAACTCAGCCGGTCGTCTTACTTCGACGACGACTGCGAGGGAGAATTAG ATTTCGAAGATGGAAGCAGGAGTCTGAACGAGTTCGAATTCTCCGCCAGGTTCAGATCTGCTGGGTCGAGTCAGACCGAATCCATGAGCTCCGCCGACGA GCTGTTCTTGAACGGGCAGATCCGGCCTCCGGTTCTCGCTCCGTTGCTTGATCTGGACGAAGAAGAAGAAGGCGAAGAAGCAAGGGAGGGGAGAAATGGG TATAATGGGGAGAGCAGAGGTAGAGATTCGGAGAACCAGATCTATGTCCCCTCTTCGATCCTCCCAGTTGGATGA
AA sequence Show only first row Show all	>Lus10040164 pacid=23174118 polypeptide=Lus10040164 locus=Lus10040164.g ID=Lus10040164.BGIv1.0 annot-version=v1.0 MMKRNEEKTHCSSYTYSQLSRSSYFDDDCEGELDFEDGSRSLNEFEFSARFRSAGSSQTESMSSADELFLNGQIRPPVLAPLLDLDEEEEGEEAREGRNG YNGESRGRDSENQIYVPSSILPVG

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10040164 [exp]	0	1
AT3G63440		ATCKX6, CKX6, A...	CYTOKININ OXIDASE 6, cytokinin...		Lus10039574 [exp]	4.4	0.7450
AT3G18420			Protein prenylyltransferase su...		Lus10035087 [exp]	15.5	0.7438
AT1G21550			Calcium-binding EF-hand family...		Lus10042761 [exp]	19.3	0.6832
AT3G15140			Polynucleotidyl transferase, r...		Lus10024133 [exp]	20.5	0.7325
AT5G12300			Calcium-dependent lipid-bindin...		Lus10001346 [exp]	22.2	0.7347
AT2G34200			RING/FYVE/PHD zinc finger supe...		Lus10007293 [exp]	29.7	0.7132
AT5G53970		TAT7	tyrosine aminotransferase 7, T...		Lus10033660 [exp]	32.9	0.7025
					Lus10032385 [exp]	35.8	0.6836
AT2G29540		ATRPAC14, ATRPC...	RNApolymerase 14 kDa subunit (...		Lus10016452 [exp]	38.2	0.6658
AT5G62440			Protein of unknown function (D...		Lus10024968 [exp]	38.9	0.6917

Compare expression of checked genes

Lus10040164 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.