Lus10040168 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10004371 47 / 3e-06 AT5G47240 410 / 2e-139 nudix hydrolase homolog 8 (.1)
Lus10040169 44 / 1e-05 AT5G47240 409 / 7e-143 nudix hydrolase homolog 8 (.1)
Poplar homologues

No hit found

PFAM info
Representative CDS sequence
>Lus10040168 pacid=23174153 polypeptide=Lus10040168 locus=Lus10040168.g ID=Lus10040168.BGIv1.0 annot-version=v1.0
ATGATTCATACTAACACTGAATACTGTGTTGATTCGACTGCTATCGAAACATCAAGATTACTGCATAACCCTGATGCTTTTGCCTCTCGGCTCCTTTCCT
GTCTTTCCCATTGGAGAACCAAGATTTTGTTCTTTTTGTGTACGCCGGAACCATTATCCACCCAGATGAGTGTAGATGACTATGAGATTCAAGCTGCTAG
GTGTACCGATTTGGCCATCACCTCGATAGCCATGAGATTGTTCCTGATACTTGTTTTAGCTTTCCTATTTTCAAGAGGGAGTTCTCCTTGTTTAATGTGT
GCTTCAGTGATCAATTACTTCAATTCCATCTTCAGTACATTCAATGGTACAACAAGAACAGAGTTGCTCTGTGGTGAAATGGCTATGGAAGACATTATCT
CAAGGCTCAAGCTGATGGATGCATGGTTGAAAGAATTCCAGTGGGCAACTTTGCCAAGGCTTAGCTCCAACTTTGTATCTCCATGA
AA sequence
>Lus10040168 pacid=23174153 polypeptide=Lus10040168 locus=Lus10040168.g ID=Lus10040168.BGIv1.0 annot-version=v1.0
MIHTNTEYCVDSTAIETSRLLHNPDAFASRLLSCLSHWRTKILFFLCTPEPLSTQMSVDDYEIQAARCTDLAITSIAMRLFLILVLAFLFSRGSSPCLMC
ASVINYFNSIFSTFNGTTRTELLCGEMAMEDIISRLKLMDAWLKEFQWATLPRLSSNFVSP

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
Lus10040168 0 1
AT4G38840 SAUR-like auxin-responsive pro... Lus10008996 3.9 0.8649
AT2G02800 Kin2, APK2B protein kinase 2B (.1.2) Lus10042192 4.9 0.8431
AT4G38840 SAUR-like auxin-responsive pro... Lus10008999 6.5 0.8369
AT4G24270 EMB140 EMBRYO DEFECTIVE 140 (.1.2) Lus10016122 8.7 0.8199
AT5G18020 SAUR-like auxin-responsive pro... Lus10039020 9.2 0.8211
AT5G66440 unknown protein Lus10024273 10.0 0.6957
AT5G54250 HLM1, DND2, ATC... DEFENSE, NO DEATH 2, cyclic nu... Lus10010061 13.0 0.8116
AT1G23965 unknown protein Lus10030641 17.0 0.7966
AT3G20820 Leucine-rich repeat (LRR) fami... Lus10031254 17.3 0.7913
AT4G38840 SAUR-like auxin-responsive pro... Lus10008995 17.9 0.7857

Lus10040168 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.