Lus10040170 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G17486 283 / 8e-98 PPPDE putative thiol peptidase family protein (.1.2)
AT5G47310 280 / 3e-96 PPPDE putative thiol peptidase family protein (.1)
AT1G47740 223 / 4e-73 PPPDE putative thiol peptidase family protein (.1.2)
AT2G25190 211 / 5e-69 PPPDE putative thiol peptidase family protein (.1)
AT5G25170 208 / 5e-68 PPPDE putative thiol peptidase family protein (.1)
AT1G80690 206 / 3e-67 PPPDE putative thiol peptidase family protein (.1)
AT4G31980 201 / 1e-60 unknown protein
AT4G25680 81 / 3e-18 PPPDE putative thiol peptidase family protein (.1)
AT4G25660 81 / 4e-18 PPPDE putative thiol peptidase family protein (.1)
AT3G07090 67 / 4e-13 PPPDE putative thiol peptidase family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10004755 370 / 6e-132 AT4G17486 273 / 2e-93 PPPDE putative thiol peptidase family protein (.1.2)
Lus10007844 355 / 6e-126 AT4G17486 277 / 3e-95 PPPDE putative thiol peptidase family protein (.1.2)
Lus10004372 327 / 1e-110 AT5G47310 244 / 1e-77 PPPDE putative thiol peptidase family protein (.1)
Lus10043293 243 / 3e-81 AT4G17486 243 / 3e-81 PPPDE putative thiol peptidase family protein (.1.2)
Lus10013657 241 / 6e-81 AT4G17486 243 / 1e-81 PPPDE putative thiol peptidase family protein (.1.2)
Lus10019437 241 / 1e-80 AT4G17486 241 / 1e-80 PPPDE putative thiol peptidase family protein (.1.2)
Lus10033030 231 / 2e-76 AT4G17486 225 / 3e-74 PPPDE putative thiol peptidase family protein (.1.2)
Lus10032708 223 / 2e-73 AT1G47740 357 / 1e-125 PPPDE putative thiol peptidase family protein (.1.2)
Lus10003951 221 / 6e-73 AT1G47740 358 / 8e-126 PPPDE putative thiol peptidase family protein (.1.2)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.001G154400 318 / 3e-111 AT5G47310 308 / 4e-107 PPPDE putative thiol peptidase family protein (.1)
Potri.003G080300 317 / 5e-111 AT5G47310 295 / 9e-102 PPPDE putative thiol peptidase family protein (.1)
Potri.018G070600 229 / 2e-76 AT4G17486 235 / 1e-78 PPPDE putative thiol peptidase family protein (.1.2)
Potri.006G154400 225 / 8e-75 AT4G17486 220 / 8e-73 PPPDE putative thiol peptidase family protein (.1.2)
Potri.002G134200 223 / 8e-74 AT1G47740 346 / 3e-121 PPPDE putative thiol peptidase family protein (.1.2)
Potri.014G042300 221 / 5e-73 AT1G47740 339 / 2e-118 PPPDE putative thiol peptidase family protein (.1.2)
Potri.T126004 217 / 2e-71 AT1G47740 337 / 2e-117 PPPDE putative thiol peptidase family protein (.1.2)
Potri.009G113168 216 / 6e-71 AT1G47740 335 / 6e-117 PPPDE putative thiol peptidase family protein (.1.2)
Potri.006G261500 216 / 7e-71 AT5G25170 313 / 5e-109 PPPDE putative thiol peptidase family protein (.1)
Potri.004G151200 214 / 6e-70 AT1G47740 335 / 1e-116 PPPDE putative thiol peptidase family protein (.1.2)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0125 Peptidase_CA PF05903 Peptidase_C97 PPPDE putative peptidase domain
Representative CDS sequence
>Lus10040170 pacid=23174012 polypeptide=Lus10040170 locus=Lus10040170.g ID=Lus10040170.BGIv1.0 annot-version=v1.0
ATGCATTTCTTTCCTTTCAGCTCAAGTTCTCGCAATGAAGGGAGGAATCGTGTTCCGGTATATCTGAATGTGTACGATCTCACCTCTGTAAATAACTACC
TCTATTGGTTCGGCCTCGGCATTTTCCATTCCGGCGTTGAAGTCCACGGGATGGAGTTTAGTTTTGGAGCACATGAGTACCCTAGCAGTGGGATATTTGA
GGTGGAACCACGAAGTTGTCCAGGGTTCATCTTTCGACGAGCAGTGTATCTGGGAAAAACCAGCATGTCACGTGCAGAAGTTCAGTTGTTGATGGAGCAT
ATTTCTACAGACTATCACGGTGATTGTTATCATCTGATTGCCAAAAATTGCAATCACTTCACAAATGATGCTTGCGTGAAACTAACAGGGAAGACTATCC
CCGGATGGGTAAATCGGATGGCTAGGTTAGGTTCATTCTGCAATTGTCTGCTGCCAGAAAGTATTAAGATAGCATCGGTTCGACGTCTCCCCGAACATGC
AGCACTTTCTGATGACGATGAGTCAGGATCGATCATGTCGTTGGCTTCATTGGCAAGTGACGAGGAGAATTCAAATCACCACCTGCTACCCATACCCAAC
GGCGAGGTTTCATTTATAAAGGAGAAACCTATCAGGCTAGCTAAAGAACTGCTATAG
AA sequence
>Lus10040170 pacid=23174012 polypeptide=Lus10040170 locus=Lus10040170.g ID=Lus10040170.BGIv1.0 annot-version=v1.0
MHFFPFSSSSRNEGRNRVPVYLNVYDLTSVNNYLYWFGLGIFHSGVEVHGMEFSFGAHEYPSSGIFEVEPRSCPGFIFRRAVYLGKTSMSRAEVQLLMEH
ISTDYHGDCYHLIAKNCNHFTNDACVKLTGKTIPGWVNRMARLGSFCNCLLPESIKIASVRRLPEHAALSDDDESGSIMSLASLASDEENSNHHLLPIPN
GEVSFIKEKPIRLAKELL

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT4G17486 PPPDE putative thiol peptidase... Lus10040170 0 1
AT4G30340 ATDGK7 diacylglycerol kinase 7 (.1) Lus10015514 21.5 0.9063
AT3G10915 Reticulon family protein (.1.2... Lus10029041 23.4 0.9061
AT5G49525 unknown protein Lus10017078 28.0 0.9055
AT4G31830 unknown protein Lus10010682 42.5 0.8940
AT4G18220 Drug/metabolite transporter su... Lus10043396 42.7 0.8967
AT3G26890 unknown protein Lus10031999 47.7 0.8923
AT3G55520 FKBP-like peptidyl-prolyl cis-... Lus10040280 55.0 0.8952
Lus10043397 85.1 0.8907
AT2G32070 Polynucleotidyl transferase, r... Lus10018330 87.5 0.8852
AT2G29410 ATMTPB1, MTPB1 metal tolerance protein B1 (.1... Lus10016487 88.7 0.8845

Lus10040170 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.