Lus10040172 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G58210 49 / 5e-08 EMB1674 EMBRYO DEFECTIVE 1674, kinase interacting family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10004374 177 / 2e-57 AT1G58210 112 / 6e-28 EMBRYO DEFECTIVE 1674, kinase interacting family protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.017G036100 48 / 1e-07 AT1G58210 127 / 6e-33 EMBRYO DEFECTIVE 1674, kinase interacting family protein (.1)
Potri.007G124300 40 / 8e-05 AT1G58210 113 / 5e-27 EMBRYO DEFECTIVE 1674, kinase interacting family protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF09133 SANTA SANTA (SANT Associated)
Representative CDS sequence
>Lus10040172 pacid=23174114 polypeptide=Lus10040172 locus=Lus10040172.g ID=Lus10040172.BGIv1.0 annot-version=v1.0
ATGCAGAGTGGCTTTCCCGTTTCAGTATGCAACAGGTTCCTGCTCGGATTTCCTCATGACTGGGAAGATGTTACAGCTCACCTTGATGCTAGCGACAGTA
GAGGTGTTCCAGCTCTGTTTCTGACCTCCTTTGATGATCTATCGGTAACAAAGCTTCACGATCTCGCAATGTCAATTCCCAAAGGTTCCGGAGGTGATTT
CTGGGACATGATAGTGAAAGAGCACAAAGGGGACGAAGTAGATATCAAACACGTTCCCAGCGTGAAAACCTCGGAAGCAGGTAACGGAAATGTCAGCATA
GGGTGA
AA sequence
>Lus10040172 pacid=23174114 polypeptide=Lus10040172 locus=Lus10040172.g ID=Lus10040172.BGIv1.0 annot-version=v1.0
MQSGFPVSVCNRFLLGFPHDWEDVTAHLDASDSRGVPALFLTSFDDLSVTKLHDLAMSIPKGSGGDFWDMIVKEHKGDEVDIKHVPSVKTSEAGNGNVSI
G

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G58210 EMB1674 EMBRYO DEFECTIVE 1674, kinase ... Lus10040172 0 1
AT1G20696 NFD3, NFD03, HM... high mobility group B3 (.1.2.3... Lus10012250 27.6 0.7540
AT3G08720 ATPK2, ATPK19, ... ARABIDOPSIS THALIANA SERINE/TH... Lus10036653 40.8 0.7369
AT1G71490 Tetratricopeptide repeat (TPR)... Lus10025488 88.2 0.7030
Lus10024539 95.0 0.7040
AT5G45790 Ubiquitin carboxyl-terminal hy... Lus10014590 106.7 0.6458
AT4G31580 SRZ22, RSZP22, ... RS-containing zinc finger prot... Lus10020123 131.5 0.6873
AT3G19184 B3 AP2/B3-like transcriptional fa... Lus10014586 138.7 0.6384
AT5G36930 Disease resistance protein (TI... Lus10008027 190.9 0.6531
AT1G53530 Peptidase S24/S26A/S26B/S26C f... Lus10015272 205.9 0.6571
AT1G70250 receptor serine/threonine kina... Lus10008335 221.6 0.6412

Lus10040172 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.