Lus10040190 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G40110 228 / 1e-78 Yippee family putative zinc-binding protein (.1.2)
AT3G11230 202 / 1e-68 Yippee family putative zinc-binding protein (.1.2)
AT3G08990 182 / 9e-61 Yippee family putative zinc-binding protein (.1.2)
AT3G55890 169 / 2e-55 Yippee family putative zinc-binding protein (.1)
AT5G53940 163 / 4e-53 Yippee family putative zinc-binding protein (.1)
AT4G27745 118 / 1e-35 Yippee family putative zinc-binding protein (.1)
AT4G27740 92 / 3e-25 Yippee family putative zinc-binding protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10028300 262 / 3e-92 AT2G40110 228 / 8e-79 Yippee family putative zinc-binding protein (.1.2)
Lus10035531 175 / 1e-57 AT3G08990 174 / 2e-57 Yippee family putative zinc-binding protein (.1.2)
Lus10027762 174 / 3e-57 AT2G40110 173 / 4e-57 Yippee family putative zinc-binding protein (.1.2)
Lus10015416 146 / 4e-46 AT5G53940 169 / 1e-55 Yippee family putative zinc-binding protein (.1)
Lus10013992 144 / 1e-45 AT5G53940 157 / 1e-50 Yippee family putative zinc-binding protein (.1)
Lus10007773 122 / 3e-37 AT4G27745 186 / 7e-63 Yippee family putative zinc-binding protein (.1)
Lus10000335 119 / 6e-36 AT4G27745 195 / 2e-66 Yippee family putative zinc-binding protein (.1)
Lus10033226 119 / 8e-36 AT4G27745 194 / 6e-66 Yippee family putative zinc-binding protein (.1)
Lus10023244 105 / 3e-30 AT4G27740 124 / 2e-38 Yippee family putative zinc-binding protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.008G067100 235 / 7e-81 AT2G40110 232 / 1e-79 Yippee family putative zinc-binding protein (.1.2)
Potri.010G190000 232 / 2e-80 AT2G40110 224 / 6e-77 Yippee family putative zinc-binding protein (.1.2)
Potri.016G115000 157 / 1e-50 AT3G11230 154 / 2e-49 Yippee family putative zinc-binding protein (.1.2)
Potri.011G115700 153 / 4e-49 AT5G53940 187 / 1e-62 Yippee family putative zinc-binding protein (.1)
Potri.001G085400 121 / 7e-37 AT4G27745 197 / 3e-67 Yippee family putative zinc-binding protein (.1)
Potri.015G009200 121 / 1e-36 AT4G27745 201 / 1e-68 Yippee family putative zinc-binding protein (.1)
Potri.012G019100 120 / 3e-36 AT4G27745 202 / 2e-69 Yippee family putative zinc-binding protein (.1)
Potri.003G145400 118 / 1e-35 AT4G27745 179 / 3e-60 Yippee family putative zinc-binding protein (.1)
Potri.006G015500 118 / 2e-35 AT3G08990 122 / 6e-37 Yippee family putative zinc-binding protein (.1.2)
Potri.014G101600 112 / 3e-33 AT4G27745 154 / 2e-50 Yippee family putative zinc-binding protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0080 Beta-tent PF03226 Yippee-Mis18 Yippee zinc-binding/DNA-binding /Mis18, centromere assembly
Representative CDS sequence
>Lus10040190 pacid=23173976 polypeptide=Lus10040190 locus=Lus10040190.g ID=Lus10040190.BGIv1.0 annot-version=v1.0
ATGGGGAGGCTGTTTGTGGTGAGTCTTGAAGGGAAGATCTATAGCTGCAAGCACTGTAGAACCCATCTTGCTCTTTCTGAAGATATTGTGTCAAAGTCTT
TCCACTCCAGGCATGGGAAAGCTTATCTCTTCAGCAAGGTAGTGAACGTCAGTATGGGTGATAAAGAGGAGAGATTGATGATGACCGGAAAGCATACAGT
TGCTGACATTTTCTGTGTCGGATGTGGATCAATTGTGGGCTGGAAATATGAGACTGCCCATGAAAAGAGCCAGAAGTACAAGGAAGGAAAATCTGTTCTT
GAACGGTTTAAGGTGTCTGGCCCTGATGGGAGCAGTTACTGGGTGAATCATGAAGCTCATGTGGGTGGCAGTGATGCAGATGATGTTTGA
AA sequence
>Lus10040190 pacid=23173976 polypeptide=Lus10040190 locus=Lus10040190.g ID=Lus10040190.BGIv1.0 annot-version=v1.0
MGRLFVVSLEGKIYSCKHCRTHLALSEDIVSKSFHSRHGKAYLFSKVVNVSMGDKEERLMMTGKHTVADIFCVGCGSIVGWKYETAHEKSQKYKEGKSVL
ERFKVSGPDGSSYWVNHEAHVGGSDADDV

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT2G40110 Yippee family putative zinc-bi... Lus10040190 0 1
AT5G20090 Uncharacterised protein family... Lus10038250 2.2 0.9464
AT5G18640 alpha/beta-Hydrolases superfam... Lus10012812 3.2 0.9172
AT4G27745 Yippee family putative zinc-bi... Lus10007773 8.6 0.9318
AT4G06676 unknown protein Lus10019950 9.4 0.9172
AT5G03455 ACR2, ARATH;CDC... ARSENATE REDUCTASE 2, Rhodanes... Lus10023923 9.9 0.8853
AT2G42780 unknown protein Lus10031380 11.3 0.8950
AT5G07910 Leucine-rich repeat (LRR) fami... Lus10000681 12.7 0.9315
AT1G15740 Leucine-rich repeat family pro... Lus10038107 14.1 0.9284
AT1G55160 unknown protein Lus10019322 17.0 0.9130
AT3G58170 ATBET11, ATBS14... ARABIDOPSIS THALIANA BET1P/SFT... Lus10033868 17.0 0.9129

Lus10040190 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.