Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G55960 78 / 2e-18 Haloacid dehalogenase-like hydrolase (HAD) superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10028284 [exp] 88 / 2e-22 AT3G55960 383 / 2e-134 Haloacid dehalogenase-like hydrolase (HAD) superfamily protein (.1) Lus10014844 [exp] 82 / 5e-20 AT3G55960 441 / 2e-157 Haloacid dehalogenase-like hydrolase (HAD) superfamily protein (.1) Lus10009890 [exp] 81 / 1e-19 AT3G55960 445 / 9e-159 Haloacid dehalogenase-like hydrolase (HAD) superfamily protein (.1) Lus10004810 [exp] 63 / 6e-13 AT3G55960 295 / 3e-99 Haloacid dehalogenase-like hydrolase (HAD) superfamily protein (.1) Lus10002484 [exp] 63 / 6e-13 AT3G55960 333 / 2e-114 Haloacid dehalogenase-like hydrolase (HAD) superfamily protein (.1) Lus10007321 [exp] 38 / 0.0003 AT5G45700 206 / 3e-65 Haloacid dehalogenase-like hydrolase (HAD) superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.010G188500 [exp] 78 / 1e-18 AT3G55960 406 / 8e-144 Haloacid dehalogenase-like hydrolase (HAD) superfamily protein (.1) Potri.006G100800 [exp] 77 / 3e-18 AT3G55960 304 / 6e-103 Haloacid dehalogenase-like hydrolase (HAD) superfamily protein (.1) Potri.016G116700 [exp] 77 / 4e-18 AT3G55960 248 / 1e-81 Haloacid dehalogenase-like hydrolase (HAD) superfamily protein (.1) Potri.008G068800 [exp] 73 / 7e-17 AT3G55960 342 / 3e-118 Haloacid dehalogenase-like hydrolase (HAD) superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0137 [flax] [poplar] HAD PF03031 [flax] [poplar] NIF NLI interacting factor-like phosphatase
Representative CDS sequence Show only first row Show all	>Lus10040202 pacid=23173973 polypeptide=Lus10040202 locus=Lus10040202.g ID=Lus10040202.BGIv1.0 annot-version=v1.0 ATGTGGGGAAGCCTATTTGAGCTGAATTTTGGGTTAAAGGACGGTGAAGGAAAACCTAAGATCAATTATCTGACAGTGTTTGAGCGTCCAGGGTTGTACG ATTTCCTCAAACAGCTCAGTGAATTTGCTGATCTTGTGCTCTTCACTGCTGGCTTGGAAGGCCGAGCAGAGGATACGCAGGTAGAAACACTCGAAAAACT CTTTCAGCAAAGTCCTCTTCACGATGTTATCCTTCCACTCCTCAAGCAATTGTCTCAGCAGGTCGACGTTAGGACTGTACTTTACTAG
AA sequence Show only first row Show all	>Lus10040202 pacid=23173973 polypeptide=Lus10040202 locus=Lus10040202.g ID=Lus10040202.BGIv1.0 annot-version=v1.0 MWGSLFELNFGLKDGEGKPKINYLTVFERPGLYDFLKQLSEFADLVLFTAGLEGRAEDTQVETLEKLFQQSPLHDVILPLLKQLSQQVDVRTVLY

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G55960			Haloacid dehalogenase-like hyd...		Lus10040202 [exp]	0	1
AT2G42620		PPS, PP2, ORE9,...	PLEIOTROPIC PHOTOSIGNALING, OR...		Lus10040230 [exp]	2.4	0.8244
					Lus10013649 [exp]	3.2	0.8280
					Lus10013650 [exp]	3.5	0.8388
AT4G31115			Protein of unknown function (D...		Lus10018151 [exp]	4.0	0.7762
AT1G13570			F-box/RNI-like superfamily pro...		Lus10020638 [exp]	6.0	0.7632
AT2G25660		EMB2410	embryo defective 2410 (.1)		Lus10012414 [exp]	6.0	0.7928
					Lus10039764 [exp]	6.3	0.8226
AT5G52260	MYB	ATMYB19	myb domain protein 19 (.1)		Lus10005740 [exp]	6.7	0.8218
AT1G14040			EXS (ERD1/XPR1/SYG1) family pr...		Lus10000203 [exp]	15.1	0.7417
AT2G23140			RING/U-box superfamily protein...		Lus10019306 [exp]	18.1	0.6744

Compare expression of checked genes

Lus10040202 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.