Plant FIBer expression Database

Lus10040204 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G66550 154 / 2e-48 Maf-like protein (.1)
AT5G42770 140 / 1e-42 Maf-like protein (.1.2)
AT2G25500 97 / 1e-27 Inosine triphosphate pyrophosphatase family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10040470
[exp]
203 / 6e-68 AT5G66550 268 / 3e-92 Maf-like protein (.1)
Lus10002531
[exp]
140 / 2e-42 AT5G42770 307 / 8e-107 Maf-like protein (.1.2)
Lus10036572
[exp]
105 / 2e-30 AT5G66550 72 / 9e-17 Maf-like protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.007G025000
[exp]
156 / 4e-49 AT5G66550 278 / 1e-95 Maf-like protein (.1)
Potri.014G196400
[exp]
145 / 1e-44 AT5G42770 309 / 2e-107 Maf-like protein (.1.2)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0269 Maf PF02545 Maf Maf-like protein
Representative CDS sequence
>Lus10040204 pacid=23174180 polypeptide=Lus10040204 locus=Lus10040204.g ID=Lus10040204.BGIv1.0 annot-version=v1.0
ATGTTGAAACATCCCTTTAAGATAATACTCGGTTCTGCCTCGATGGGCTATGAATTCACTTTGATGAGTGCAGATATTGATGAGCAAAGTATAAGGAAGG
ACAAGGCAGAGGAGTTGGTGATGGCCCTAGCTGAGGCTAAGGCAGATCCCATCGTAGCAAAGCTGCCGAACACAGACCAAATGAAGAACTGTAGTGATCC
TACAGTGTTGGTTACTGCAGATACGGTTGTGGTATACAAAGGAGTAGTGAAAGAGAAGCCAACCAGCGAGGAAGAAGCGCGGGAATTCATCAAAGGTTAT
TCCGGTGGTCATGCAGCTGTTGTAGGGTCCGTACTTGTAACCAATCTCGCAACAGGATCGACAAGAGGAGGTTAA
AA sequence
>Lus10040204 pacid=23174180 polypeptide=Lus10040204 locus=Lus10040204.g ID=Lus10040204.BGIv1.0 annot-version=v1.0
MLKHPFKIILGSASMGYEFTLMSADIDEQSIRKDKAEELVMALAEAKADPIVAKLPNTDQMKNCSDPTVLVTADTVVVYKGVVKEKPTSEEEAREFIKGY
SGGHAAVVGSVLVTNLATGSTRGG

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G66550 Maf-like protein (.1) Lus10040204
[exp]
0 1
AT5G04050 RNA-directed DNA polymerase (r... Lus10036278
[exp]
1.4 0.9155
AT2G25660 EMB2410 embryo defective 2410 (.1) Lus10022111
[exp]
2.0 0.9019
AT1G26930 Galactose oxidase/kelch repeat... Lus10024239
[exp]
2.4 0.8940
AT5G02250 ATMTRNASEII, RN... ribonucleotide reductase 1, EM... Lus10010842
[exp]
4.9 0.8626
AT4G30580 LPAT1, ATS2, EM... lysophosphatidic acid acyltran... Lus10022158
[exp]
6.6 0.8334
AT5G44440 FAD-binding Berberine family p... Lus10023367
[exp]
7.3 0.8097
AT2G20020 CAF1, ATCAF1 RNA-binding CRS1 / YhbY (CRM) ... Lus10034952
[exp]
8.5 0.8450
Lus10042563
[exp]
10.2 0.8213
AT5G22640 EMB1211 embryo defective 1211, MORN (M... Lus10034504
[exp]
10.6 0.8428
AT3G22630 PRCGB, PBD1 20S proteasome beta subunit D1... Lus10006596
[exp]
10.8 0.8387

Lus10040204 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.