Lus10040208 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G35450 49 / 7e-07 Disease resistance protein (CC-NBS-LRR class) family (.1)
AT3G14470 47 / 4e-06 NB-ARC domain-containing disease resistance protein (.1)
AT5G48620 46 / 6e-06 Disease resistance protein (CC-NBS-LRR class) family (.1)
AT5G43470 46 / 7e-06 HRT, RCY1, RPP8 RECOGNITION OF PERONOSPORA PARASITICA 8, RESISTANT TO CMV\(Y\) 1, HYPERSENSITIVE RESPONSE TO TCV, Disease resistance protein (CC-NBS-LRR class) family (.1), Disease resistance protein (CC-NBS-LRR class) family (.2)
AT3G14460 43 / 6e-05 LRR and NB-ARC domains-containing disease resistance protein (.1)
AT3G46530 43 / 8e-05 RPP13 RECOGNITION OF PERONOSPORA PARASITICA 13, NB-ARC domain-containing disease resistance protein (.1)
AT3G46730 42 / 0.0001 NB-ARC domain-containing disease resistance protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10028279 169 / 9e-49 AT3G14470 337 / 5e-99 NB-ARC domain-containing disease resistance protein (.1)
Lus10042117 144 / 6e-40 AT3G14470 354 / 2e-105 NB-ARC domain-containing disease resistance protein (.1)
Lus10005218 77 / 2e-16 AT3G14470 379 / 2e-113 NB-ARC domain-containing disease resistance protein (.1)
Lus10006794 76 / 4e-16 AT3G14470 264 / 2e-78 NB-ARC domain-containing disease resistance protein (.1)
Lus10011278 67 / 4e-13 AT3G14470 356 / 1e-105 NB-ARC domain-containing disease resistance protein (.1)
Lus10022351 57 / 1e-09 AT3G14470 369 / 1e-108 NB-ARC domain-containing disease resistance protein (.1)
Lus10002609 53 / 2e-08 AT3G14470 364 / 9e-110 NB-ARC domain-containing disease resistance protein (.1)
Lus10022792 52 / 6e-08 AT3G14470 343 / 7e-102 NB-ARC domain-containing disease resistance protein (.1)
Lus10003571 52 / 7e-08 AT3G14470 363 / 6e-110 NB-ARC domain-containing disease resistance protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.006G275800 77 / 2e-16 AT3G14470 345 / 3e-100 NB-ARC domain-containing disease resistance protein (.1)
Potri.006G271800 75 / 7e-16 AT3G14470 345 / 7e-102 NB-ARC domain-containing disease resistance protein (.1)
Potri.006G272066 74 / 2e-15 AT3G14470 299 / 2e-85 NB-ARC domain-containing disease resistance protein (.1)
Potri.006G273900 71 / 2e-14 AT3G14470 364 / 1e-108 NB-ARC domain-containing disease resistance protein (.1)
Potri.017G140132 66 / 9e-13 AT3G14470 292 / 1e-84 NB-ARC domain-containing disease resistance protein (.1)
Potri.017G143820 66 / 1e-12 AT3G14470 316 / 3e-93 NB-ARC domain-containing disease resistance protein (.1)
Potri.004G076700 62 / 2e-11 AT3G14470 143 / 4e-35 NB-ARC domain-containing disease resistance protein (.1)
Potri.017G143700 62 / 2e-11 AT3G14470 286 / 2e-82 NB-ARC domain-containing disease resistance protein (.1)
Potri.017G143433 61 / 4e-11 AT3G14470 321 / 1e-94 NB-ARC domain-containing disease resistance protein (.1)
Potri.017G121700 57 / 8e-10 AT3G14470 461 / 2e-144 NB-ARC domain-containing disease resistance protein (.1)
PFAM info
Representative CDS sequence
>Lus10040208 pacid=23174066 polypeptide=Lus10040208 locus=Lus10040208.g ID=Lus10040208.BGIv1.0 annot-version=v1.0
ATGGCTGCTGCTTCTGTCTTCAGGGTTGGCAAAACAGTTCTGAAGAAACTGGGTCCTCTCATCCAACAAGAGGCTTCCTCACTATGGACTCTTCGAGCAG
AGCTCGAGAAGCTGAAAGGCACGATGAGTGCCATTCAGGCTCTCCTCCTCGACGTGGAGGAGAAGCACGAACACAGTCATCAAGTCAAAGACTGGCTCGA
GAAGCTGACAGTCTTACTGTTCGATGCTGAGGATCTGCTCGACGATGTTGCTACTGAAGATTTGCGCGCAACTCCACCTCATGATGATAATGACTTGAGA
TGCACGACGTGTGAACTTCGATTTGGAGAAATGGAGCGTTCTAAAATCCGCCTCGCGAGAGGTGGCCCCACCCGAAGCAAGATCCTCGTCACTACGAGAT
TCGAGAATTTCGCAGAGTCGATGAGGAATCGTGGTTCTCCCGCGCCTTACACTCTGCCCGGTCTATCTCCTTCCCTGTCGTGGTCATTGGTTATGAAGGT
AGCATTGGCATCATCATCATCAAATGAAGAGAGTATACAAAACATAACAGACCAAGAATAA
AA sequence
>Lus10040208 pacid=23174066 polypeptide=Lus10040208 locus=Lus10040208.g ID=Lus10040208.BGIv1.0 annot-version=v1.0
MAAASVFRVGKTVLKKLGPLIQQEASSLWTLRAELEKLKGTMSAIQALLLDVEEKHEHSHQVKDWLEKLTVLLFDAEDLLDDVATEDLRATPPHDDNDLR
CTTCELRFGEMERSKIRLARGGPTRSKILVTTRFENFAESMRNRGSPAPYTLPGLSPSLSWSLVMKVALASSSSNEESIQNITDQE

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT3G14470 NB-ARC domain-containing disea... Lus10040208 0 1
AT5G51100 FSD2 Fe superoxide dismutase 2 (.1) Lus10003430 6.5 0.6928
AT2G38940 PHT1;4, ATPT2 ARABIDOPSIS THALIANA PHOSPHATE... Lus10014754 14.0 0.6182
AT5G15290 CASP5 Casparian strip membrane domai... Lus10033007 14.8 0.6968
AT1G32450 NRT1.5 nitrate transporter 1.5 (.1) Lus10000792 26.8 0.6579
Lus10029354 26.9 0.6757
AT2G45550 CYP76C4 "cytochrome P450, family 76, s... Lus10027430 31.4 0.6038
AT1G77410 BGAL16 beta-galactosidase 16 (.1) Lus10008259 44.8 0.6516
AT4G25650 TIC55-IV, PTC52... TRANSLOCON AT THE INNER ENVELO... Lus10025408 52.5 0.5779
Lus10005187 53.0 0.5779
AT4G33985 Protein of unknown function (D... Lus10002400 53.4 0.6113

Lus10040208 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.