Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G14460 66 / 6e-14 LRR and NB-ARC domains-containing disease resistance protein (.1) AT3G14470 63 / 5e-13 NB-ARC domain-containing disease resistance protein (.1) AT1G69550 54 / 1e-09 disease resistance protein (TIR-NBS-LRR class) (.1) AT3G04220 53 / 2e-09 Disease resistance protein (TIR-NBS-LRR class) family (.1) AT3G25510 51 / 9e-09 disease resistance protein (TIR-NBS-LRR class), putative (.1) AT2G14080 49 / 5e-08 Disease resistance protein (TIR-NBS-LRR class) family (.1) AT5G45520 49 / 8e-08 Leucine-rich repeat (LRR) family protein (.1) AT5G11250 47 / 3e-07 Disease resistance protein (TIR-NBS-LRR class) (.1) AT3G50950 46 / 7e-07 ZAR1 HOPZ-ACTIVATED RESISTANCE 1 (.1.2) AT5G44510 45 / 2e-06 TAO1 target of AVRB operation1 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10028279 [exp] 167 / 3e-49 AT3G14470 337 / 5e-99 NB-ARC domain-containing disease resistance protein (.1) Lus10042117 [exp] 115 / 2e-31 AT3G14470 354 / 2e-105 NB-ARC domain-containing disease resistance protein (.1) Lus10008584 [exp] 76 / 3e-17 AT3G14470 186 / 2e-49 NB-ARC domain-containing disease resistance protein (.1) Lus10005218 [exp] 63 / 6e-13 AT3G14470 379 / 2e-113 NB-ARC domain-containing disease resistance protein (.1) Lus10011278 [exp] 61 / 4e-12 AT3G14470 356 / 1e-105 NB-ARC domain-containing disease resistance protein (.1) Lus10005321 [exp] 60 / 1e-11 AT3G14460 607 / 0.0 LRR and NB-ARC domains-containing disease resistance protein (.1) Lus10022900 [exp] 59 / 2e-11 AT3G14470 350 / 2e-104 NB-ARC domain-containing disease resistance protein (.1) Lus10039540 [exp] 57 / 8e-11 AT3G14470 727 / 0.0 NB-ARC domain-containing disease resistance protein (.1) Lus10026132 [exp] 57 / 1e-10 AT3G14460 594 / 0.0 LRR and NB-ARC domains-containing disease resistance protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.006G272066 [exp] 84 / 3e-20 AT3G14470 299 / 2e-85 NB-ARC domain-containing disease resistance protein (.1) Potri.006G273900 [exp] 81 / 3e-19 AT3G14470 364 / 1e-108 NB-ARC domain-containing disease resistance protein (.1) Potri.006G271800 [exp] 81 / 5e-19 AT3G14470 345 / 7e-102 NB-ARC domain-containing disease resistance protein (.1) Potri.006G275800 [exp] 79 / 2e-18 AT3G14470 345 / 3e-100 NB-ARC domain-containing disease resistance protein (.1) Potri.001G261300 [exp] 69 / 4e-15 AT3G14470 538 / 2e-170 NB-ARC domain-containing disease resistance protein (.1) Potri.004G196100 [exp] 69 / 6e-15 AT3G14470 647 / 0.0 NB-ARC domain-containing disease resistance protein (.1) Potri.017G136266 [exp] 68 / 1e-14 AT3G14470 412 / 2e-126 NB-ARC domain-containing disease resistance protein (.1) Potri.019G036850 [exp] 68 / 1e-14 AT3G14470 402 / 2e-122 NB-ARC domain-containing disease resistance protein (.1) Potri.017G133600 [exp] 68 / 1e-14 AT3G14470 424 / 4e-132 NB-ARC domain-containing disease resistance protein (.1) Potri.017G133666 [exp] 67 / 2e-14 AT3G14470 416 / 7e-129 NB-ARC domain-containing disease resistance protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0022 [flax] [poplar] LRR PF00560 [flax] [poplar] LRR_1 Leucine Rich Repeat
Representative CDS sequence Show only first row Show all	>Lus10040210 pacid=23173872 polypeptide=Lus10040210 locus=Lus10040210.g ID=Lus10040210.BGIv1.0 annot-version=v1.0 ATGGTGCCCCGTCACATTCAGGAGATGAAGCATCTCAGGCTTCTCGACCTGTCGTTTCAAGCAAAGATGACTTGCTTTCCAAGCAATATTACCATGCTTG TCAACTTACAAGTGCTTGTTCTTCATGGTTGCAGAAGCCTCCAGGAGCTGCCAAGGGATGTCATCAAGCTTGTCAATTTATGGTGCCTGAATTTAACTTG TTGCTTTGCAATGCCAAAGGGGCTTGGTAAACTCAGCCACCTTGAGAAACTGACATGGTTTGTGGTGGGAAAGGACAGCTCCGGGTTGAAAGAGTGA
AA sequence Show only first row Show all	>Lus10040210 pacid=23173872 polypeptide=Lus10040210 locus=Lus10040210.g ID=Lus10040210.BGIv1.0 annot-version=v1.0 MVPRHIQEMKHLRLLDLSFQAKMTCFPSNITMLVNLQVLVLHGCRSLQELPRDVIKLVNLWCLNLTCCFAMPKGLGKLSHLEKLTWFVVGKDSSGLKE

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G14460			LRR and NB-ARC domains-contain...		Lus10040210 [exp]	0	1
AT1G14290		SBH2	sphingoid base hydroxylase 2 (...		Lus10028717 [exp]	10.9	0.6195
AT4G26400			RING/U-box superfamily protein...		Lus10006449 [exp]	15.4	0.6195
AT1G04380			2-oxoglutarate (2OG) and Fe(II...		Lus10009240 [exp]	22.1	0.5858
AT3G04550			unknown protein		Lus10032342 [exp]	25.2	0.5706
AT3G19620			Glycosyl hydrolase family prot...		Lus10002127 [exp]	30.6	0.5788
AT5G57685		LSB1, ATGDU3	LESS SUSCEPTIBLE TO BSCTV 1, A...		Lus10008909 [exp]	31.9	0.5675
AT5G52975			Protein of unknown function (D...		Lus10001307 [exp]	37.1	0.5050
					Lus10006063 [exp]	37.1	0.5312
AT3G15510	NAC	ATNAC2, ANAC056...	NAC-REGULATED SEED MORPHOLOGY ...		Lus10007410 [exp]	42.5	0.5312
AT4G29530			Pyridoxal phosphate phosphatas...		Lus10008573 [exp]	45.4	0.5537

Compare expression of checked genes

Lus10040210 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.