Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G55820 91 / 1e-23 Fasciclin-like arabinogalactan family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10028268 [exp] 202 / 2e-67 AT3G55820 142 / 6e-43 Fasciclin-like arabinogalactan family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.010G192300 [exp] 158 / 3e-50 AT3G55820 164 / 3e-51 Fasciclin-like arabinogalactan family protein (.1) Potri.008G065101 [exp] 92 / 9e-25 AT3G55820 98 / 4e-26 Fasciclin-like arabinogalactan family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF02469 [flax] [poplar] Fasciclin Fasciclin domain
Representative CDS sequence Show only first row Show all	>Lus10040220 pacid=23173804 polypeptide=Lus10040220 locus=Lus10040220.g ID=Lus10040220.BGIv1.0 annot-version=v1.0 ATGATGGTGGAAATGCTGCCAGACGACCTTGCTTTCACGGTGTTCATGCCCTCCGAGAGAGCATTCGAGCGCGATCTCAGACTCAACAACGATAGCAGCT TCTCGAGGAATGACACGTATGCAGTGGTTTCTCGAGTTCTAGGATTCTCAGCGGTTCCCCGGACTCTTTTCTCGGCCGCGGTGGATGATGATTCATCACC GGTTTCGTACGATTCACTGTCCGGATTGACTCTATTCATCTCCAAGGATGTTGAAGGAATGCTGGTTGTGAATAGAGTTGCAGCTGAGAAGGTTGATATC AGGAGGAAGAAGAGAATCGCAGTTCATGTTATGGATGGGGTGATCATGGATGCCGAATTCGAGCAATCGGTTCAGCCTGATGATGAAGGATGA
AA sequence Show only first row Show all	>Lus10040220 pacid=23173804 polypeptide=Lus10040220 locus=Lus10040220.g ID=Lus10040220.BGIv1.0 annot-version=v1.0 MMVEMLPDDLAFTVFMPSERAFERDLRLNNDSSFSRNDTYAVVSRVLGFSAVPRTLFSAAVDDDSSPVSYDSLSGLTLFISKDVEGMLVVNRVAAEKVDI RRKKRIAVHVMDGVIMDAEFEQSVQPDDEG

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G55820			Fasciclin-like arabinogalactan...		Lus10040220 [exp]	0	1
AT1G65660		SMP1	SWELLMAP 1, Pre-mRNA splicing ...		Lus10007479 [exp]	12.5	0.7130
AT5G55640			unknown protein		Lus10043162 [exp]	13.6	0.6731
AT1G24190		SNL3, AtSin3	ARABIDOPSIS THALIANA SIN3 HOMO...		Lus10022887 [exp]	23.2	0.6387
AT2G15910			CSL zinc finger domain-contain...		Lus10023841 [exp]	32.2	0.6613
AT5G64813		LIP1	Light Insensitive Period1, Ras...		Lus10006805 [exp]	39.0	0.6496
AT3G43810		CAM7	calmodulin 7 (.1)		Lus10022589 [exp]	44.2	0.6490
AT2G27030		CAM5, CAM2, ACA...	calmodulin 5 (.1.2.3)		Lus10010386 [exp]	46.4	0.6391
AT2G19480		NFA2, NFA02, NA...	NUCLEOSOME/CHROMATIN ASSEMBLY ...		Lus10011959 [exp]	50.5	0.6086
AT1G71080			RNA polymerase II transcriptio...		Lus10042948 [exp]	53.4	0.6327
AT3G23230	AP2_ERF	ERF98	Integrase-type DNA-binding sup...		Lus10021873 [exp]	54.8	0.6013

Compare expression of checked genes

Lus10040220 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.