Lus10040227 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G25770 75 / 6e-17 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1.2)
AT4G32870 57 / 3e-10 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10028262 328 / 3e-116 AT2G25770 75 / 2e-17 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1.2)
Lus10005477 77 / 1e-17 AT2G25770 172 / 2e-55 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1.2)
Lus10006042 62 / 3e-12 AT4G32870 145 / 3e-45 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1)
Lus10000573 54 / 6e-09 AT4G32870 144 / 1e-44 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1)
Lus10026898 51 / 4e-08 AT2G25770 128 / 2e-38 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1.2)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.008G063900 236 / 7e-80 AT4G32870 80 / 2e-19 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1)
Potri.010G193200 152 / 5e-48 AT2G25770 59 / 4e-12 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1.2)
Potri.018G046100 67 / 5e-14 AT2G25770 188 / 1e-61 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1.2)
Potri.006G237000 62 / 7e-12 AT4G32870 180 / 9e-59 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1)
Potri.006G236800 57 / 8e-10 AT4G32870 179 / 1e-57 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1)
Potri.006G237100 54 / 3e-09 AT4G32870 178 / 8e-58 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0209 Bet_v_1_like PF10604 Polyketide_cyc2 Polyketide cyclase / dehydrase and lipid transport
Representative CDS sequence
>Lus10040227 pacid=23173838 polypeptide=Lus10040227 locus=Lus10040227.g ID=Lus10040227.BGIv1.0 annot-version=v1.0
ATGTATATCTTTGTGTTTAACAATTTCCTGCCTGGTAGTTCACTTTCCATCTTCAATAAGGATTACCTTGGAGTTCAAGAAATCACAGTAAAGTTACAGA
ACACAAGGGAAGAGACAAGACAACAACAAATGGAACTCGAATCAGGAGACTCGAAATGGTACGGAAGCGTGAGGGCAATCGTGGAAGCACCCATAGACCA
AGTCTGGACCATGGTTTCACAGACCAAGAGACTACCAGACTGGGTCCCAATGGTTGAAAGGTGCACAGACCTGGCTGGACAAGAAGGCCAAGTAGGCTAT
GTCCGGTTAGTGTCCGGGTTTATGTTCCCTCAAGAAGACGGTGAAAGGTCTTGGATCAAGGAGAAGTTGATCTCCATGGACTCATCATGCTACAGCTATG
AATACAAGATGGAAGCCAGTAATGTCGGCTTGGATGGCTCCGCGAACAAGCTCAAGCTTGTCGATTATGGGAACAGATCGACTTTGGTCGTGTGGTCGTT
CGAGATAGACCCTTTGCCGGGTGCCTCTCAGGATTACATTATAGACTTTTTGGGTTATGTTTACAAATCTTCCATTGGTAGGATTGGTAGTGCCATTCAA
GAAGAAAAAAAGAATGGTCCTTGA
AA sequence
>Lus10040227 pacid=23173838 polypeptide=Lus10040227 locus=Lus10040227.g ID=Lus10040227.BGIv1.0 annot-version=v1.0
MYIFVFNNFLPGSSLSIFNKDYLGVQEITVKLQNTREETRQQQMELESGDSKWYGSVRAIVEAPIDQVWTMVSQTKRLPDWVPMVERCTDLAGQEGQVGY
VRLVSGFMFPQEDGERSWIKEKLISMDSSCYSYEYKMEASNVGLDGSANKLKLVDYGNRSTLVVWSFEIDPLPGASQDYIIDFLGYVYKSSIGRIGSAIQ
EEKKNGP

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT2G25770 Polyketide cyclase/dehydrase a... Lus10040227 0 1
AT4G12110 ATSMO1-1, SMO1-... sterol-4alpha-methyl oxidase 1... Lus10004322 1.4 0.8571
AT4G18210 ATPUP10 purine permease 10 (.1) Lus10023318 1.7 0.8805
AT4G18210 ATPUP10 purine permease 10 (.1) Lus10023317 5.0 0.8192
AT1G50650 Stigma-specific Stig1 family p... Lus10000696 9.8 0.7769
AT1G79960 OFP ATOFP14, OFP14 ovate family protein 14 (.1) Lus10035891 11.0 0.7992
Lus10001030 11.2 0.7622
AT2G20835 unknown protein Lus10018561 18.5 0.8433
AT2G37540 NAD(P)-binding Rossmann-fold s... Lus10023762 26.1 0.8382
AT1G52240 PIRF1, ATROPGEF... phytochrome interacting RopGEF... Lus10022596 26.5 0.7988
AT5G36930 Disease resistance protein (TI... Lus10041606 28.4 0.7875

Lus10040227 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.