Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G59590 116 / 3e-32 UGT76E2 UDP-glucosyl transferase 76E2 (.1) AT3G55700 115 / 6e-32 UDP-Glycosyltransferase superfamily protein (.1) AT3G11340 115 / 8e-32 UGT76B1 UDP-dependent glycosyltransferase 76B1, UDP-Glycosyltransferase superfamily protein (.1) AT3G46660 115 / 1e-31 UGT76E12 UDP-glucosyl transferase 76E12 (.1) AT3G46670 114 / 1e-31 UGT76E11 UDP-glucosyl transferase 76E11 (.1) AT3G46690 112 / 1e-30 UDP-Glycosyltransferase superfamily protein (.1) AT5G05870 111 / 3e-30 UGT76C1 UDP-glucosyl transferase 76C1 (.1) AT5G59580 111 / 3e-30 UGT76E1 UDP-glucosyl transferase 76E1 (.1) AT5G05880 111 / 3e-30 UDP-Glycosyltransferase superfamily protein (.1) AT3G55710 109 / 2e-29 UDP-Glycosyltransferase superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10004671 [exp] 166 / 4e-51 AT3G55700 450 / 4e-156 UDP-Glycosyltransferase superfamily protein (.1) Lus10035681 [exp] 121 / 8e-37 AT3G11340 191 / 5e-60 UDP-dependent glycosyltransferase 76B1, UDP-Glycosyltransferase superfamily protein (.1) Lus10037268 [exp] 122 / 5e-34 AT3G11340 447 / 1e-154 UDP-dependent glycosyltransferase 76B1, UDP-Glycosyltransferase superfamily protein (.1) Lus10040246 [exp] 119 / 5e-33 AT3G11340 488 / 3e-171 UDP-dependent glycosyltransferase 76B1, UDP-Glycosyltransferase superfamily protein (.1) Lus10004672 [exp] 113 / 8e-31 AT3G11340 417 / 1e-142 UDP-dependent glycosyltransferase 76B1, UDP-Glycosyltransferase superfamily protein (.1) Lus10016460 [exp] 106 / 2e-28 AT5G59590 400 / 2e-136 UDP-glucosyl transferase 76E2 (.1) Lus10016459 [exp] 105 / 5e-28 AT5G59590 357 / 3e-119 UDP-glucosyl transferase 76E2 (.1) Lus10040725 [exp] 103 / 2e-27 AT5G59590 408 / 9e-140 UDP-glucosyl transferase 76E2 (.1) Lus10004673 [exp] 94 / 2e-25 AT3G11340 236 / 1e-76 UDP-dependent glycosyltransferase 76B1, UDP-Glycosyltransferase superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.010G195600 [exp] 125 / 1e-35 AT3G55700 515 / 0.0 UDP-Glycosyltransferase superfamily protein (.1) Potri.010G195500 [exp] 121 / 6e-34 AT3G11340 483 / 3e-169 UDP-dependent glycosyltransferase 76B1, UDP-Glycosyltransferase superfamily protein (.1) Potri.010G195300 [exp] 120 / 7e-34 AT3G11340 485 / 6e-170 UDP-dependent glycosyltransferase 76B1, UDP-Glycosyltransferase superfamily protein (.1) Potri.001G245900 [exp] 117 / 2e-32 AT3G46660 452 / 7e-157 UDP-glucosyl transferase 76E12 (.1) Potri.009G039100 [exp] 112 / 2e-30 AT3G09360 412 / 7e-134 Cyclin/Brf1-like TBP-binding protein (.1) Potri.006G039300 [exp] 101 / 1e-26 AT5G59590 347 / 2e-115 UDP-glucosyl transferase 76E2 (.1) Potri.001G312600 [exp] 94 / 1e-23 AT1G22360 586 / 0.0 UDP-glucosyl transferase 85A2 (.1.2) Potri.007G095000 [exp] 93 / 1e-23 AT1G22340 543 / 0.0 UDP-glucosyl transferase 85A7 (.1) Potri.001G313000 [exp] 93 / 2e-23 AT1G22360 564 / 0.0 UDP-glucosyl transferase 85A2 (.1.2) Potri.002G098400 [exp] 91 / 1e-22 AT1G22360 640 / 0.0 UDP-glucosyl transferase 85A2 (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0113 [flax] [poplar] GT-B PF00201 [flax] [poplar] UDPGT UDP-glucoronosyl and UDP-glucosyl transferase
Representative CDS sequence Show only first row Show all	>Lus10040243 pacid=23174146 polypeptide=Lus10040243 locus=Lus10040243.g ID=Lus10040243.BGIv1.0 annot-version=v1.0 ATGTCACCAAACTCAATAATCTATGTCAGCTTCGGCACCATTGCAGTTGCAACCGAGACCGAGTTCTTGGACATCGCGTGGGGTCTCGCGAACAGCAACC AGCGCTTTCTGTGGGTTGTTCGCCCCGGATCGGTTCGTGGATCGGAATGGCTAGAGCTCTTGCCTGACGAGTTTCATCAGGCGGTGAATGGGAGGGGTAA GATCGTAAAATGGGCACCGCAACGGCATGTGCTTGCACATCCTGCTGTTGGTGGGTTGGGATTCACTTGGAAGGTAATAGAGATAGAGTTGGGATAG
AA sequence Show only first row Show all	>Lus10040243 pacid=23174146 polypeptide=Lus10040243 locus=Lus10040243.g ID=Lus10040243.BGIv1.0 annot-version=v1.0 MSPNSIIYVSFGTIAVATETEFLDIAWGLANSNQRFLWVVRPGSVRGSEWLELLPDEFHQAVNGRGKIVKWAPQRHVLAHPAVGGLGFTWKVIEIELG

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G11340		UGT76B1	UDP-dependent glycosyltransfer...		Lus10040243 [exp]	0	1
					Lus10037930 [exp]	7.5	0.7655
AT3G11340		UGT76B1	UDP-dependent glycosyltransfer...		Lus10040245 [exp]	11.0	0.7807
AT3G49070			Protein of unknown function (D...		Lus10027501 [exp]	11.8	0.7430
AT2G44840	AP2_ERF	ATERF13, EREBP	ethylene-responsive element bi...		Lus10029334 [exp]	14.1	0.7459
AT5G48150	GRAS	PAT1	phytochrome a signal transduct...		Lus10036623 [exp]	14.4	0.7802
AT1G80840	WRKY	ATWRKY40, WRKY4...	WRKY DNA-binding protein 40 (....		Lus10024074 [exp]	18.2	0.7716
AT5G17680			disease resistance protein (TI...		Lus10041060 [exp]	22.1	0.7534
AT2G17140			Pentatricopeptide repeat (PPR)...		Lus10013832 [exp]	25.8	0.7531
AT4G37850	bHLH	bHLH025	basic helix-loop-helix (bHLH) ...		Lus10011578 [exp]	26.2	0.7213
AT2G22760	bHLH	bHLH019	basic helix-loop-helix (bHLH) ...		Lus10006085 [exp]	28.2	0.7258

Compare expression of checked genes

Lus10040243 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.