Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G11340 83 / 8e-20 UGT76B1 UDP-dependent glycosyltransferase 76B1, UDP-Glycosyltransferase superfamily protein (.1) AT5G05900 79 / 2e-18 UDP-Glycosyltransferase superfamily protein (.1) AT5G05860 75 / 6e-17 UGT76C2 UDP-glucosyl transferase 76C2 (.1) AT5G05880 70 / 3e-15 UDP-Glycosyltransferase superfamily protein (.1) AT5G05890 66 / 1e-13 UDP-Glycosyltransferase superfamily protein (.1) AT5G05870 61 / 4e-12 UGT76C1 UDP-glucosyl transferase 76C1 (.1) AT3G55700 53 / 3e-09 UDP-Glycosyltransferase superfamily protein (.1) AT1G22380 50 / 3e-08 ATUGT85A3 UDP-glucosyl transferase 85A3 (.1) AT1G22340 49 / 8e-08 ATUGT85A7 UDP-glucosyl transferase 85A7 (.1) AT1G22370 48 / 1e-07 ATUGT85A5 UDP-glucosyl transferase 85A5 (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10004672 [exp] 174 / 3e-53 AT3G11340 417 / 1e-142 UDP-dependent glycosyltransferase 76B1, UDP-Glycosyltransferase superfamily protein (.1) Lus10037268 [exp] 126 / 1e-35 AT3G11340 447 / 1e-154 UDP-dependent glycosyltransferase 76B1, UDP-Glycosyltransferase superfamily protein (.1) Lus10040244 [exp] 97 / 6e-26 AT3G55700 169 / 3e-50 UDP-Glycosyltransferase superfamily protein (.1) Lus10040246 [exp] 100 / 1e-25 AT3G11340 488 / 3e-171 UDP-dependent glycosyltransferase 76B1, UDP-Glycosyltransferase superfamily protein (.1) Lus10004671 [exp] 83 / 8e-20 AT3G55700 450 / 4e-156 UDP-Glycosyltransferase superfamily protein (.1) Lus10016460 [exp] 64 / 3e-13 AT5G59590 400 / 2e-136 UDP-glucosyl transferase 76E2 (.1) Lus10040725 [exp] 63 / 8e-13 AT5G59590 408 / 9e-140 UDP-glucosyl transferase 76E2 (.1) Lus10016459 [exp] 57 / 1e-10 AT5G59590 357 / 3e-119 UDP-glucosyl transferase 76E2 (.1) Lus10041055 [exp] 53 / 4e-09 AT1G22360 610 / 0.0 UDP-glucosyl transferase 85A2 (.1.2)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.010G195600 [exp] 107 / 9e-29 AT3G55700 515 / 0.0 UDP-Glycosyltransferase superfamily protein (.1) Potri.010G195300 [exp] 93 / 2e-23 AT3G11340 485 / 6e-170 UDP-dependent glycosyltransferase 76B1, UDP-Glycosyltransferase superfamily protein (.1) Potri.010G195500 [exp] 86 / 5e-21 AT3G11340 483 / 3e-169 UDP-dependent glycosyltransferase 76B1, UDP-Glycosyltransferase superfamily protein (.1) Potri.001G245900 [exp] 59 / 2e-11 AT3G46660 452 / 7e-157 UDP-glucosyl transferase 76E12 (.1) Potri.006G039300 [exp] 54 / 2e-09 AT5G59590 347 / 2e-115 UDP-glucosyl transferase 76E2 (.1) Potri.017G052232 [exp] 53 / 3e-09 AT1G22360 622 / 0.0 UDP-glucosyl transferase 85A2 (.1.2) Potri.017G052400 [exp] 53 / 4e-09 AT1G22360 620 / 0.0 UDP-glucosyl transferase 85A2 (.1.2) Potri.017G052100 [exp] 51 / 1e-08 AT1G22360 612 / 0.0 UDP-glucosyl transferase 85A2 (.1.2) Potri.017G052000 [exp] 51 / 2e-08 AT1G22360 617 / 0.0 UDP-glucosyl transferase 85A2 (.1.2) Potri.007G095000 [exp] 49 / 6e-08 AT1G22340 543 / 0.0 UDP-glucosyl transferase 85A7 (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10040245 pacid=23174015 polypeptide=Lus10040245 locus=Lus10040245.g ID=Lus10040245.BGIv1.0 annot-version=v1.0 ATGCTTCAACTGGCAAACATCCTCAACTCTCCAAACCCGTCAAACTACCCTGAATTCTCCTTCCACTCCATCCACCATGGCTTATCGGAAGAGGAAGCCA ATGAAGCCTCTTCTAGAGTTGTAGATGTCGCGGCTCTTCTCAACTCCATCAATATCACTTGCGTTGACCCTTTCCAGGAAGCCTTAGGGAAGCTGTTATC AGAAAACTTAGAGGAGGAGGAGCCTGTTGCTTGCCTCATTGCTGATGCCCTGTGGCACGTCACTCAGGCGGTTACTGATAGTCTCCATCTCCCCAGGATT ATGCTTAGAACAAGCGTTGCTTGTTCTTGA
AA sequence Show only first row Show all	>Lus10040245 pacid=23174015 polypeptide=Lus10040245 locus=Lus10040245.g ID=Lus10040245.BGIv1.0 annot-version=v1.0 MLQLANILNSPNPSNYPEFSFHSIHHGLSEEEANEASSRVVDVAALLNSINITCVDPFQEALGKLLSENLEEEEPVACLIADALWHVTQAVTDSLHLPRI MLRTSVACS

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G11340		UGT76B1	UDP-dependent glycosyltransfer...		Lus10040245 [exp]	0	1
AT1G74920		ALDH10A8	aldehyde dehydrogenase 10A8 (....		Lus10004239 [exp]	6.4	0.9075
AT1G15910		FDM1	factor of DNA methylation 1, X...		Lus10040287 [exp]	8.0	0.9050
AT5G48150	GRAS	PAT1	phytochrome a signal transduct...		Lus10036623 [exp]	9.5	0.8898
AT1G29670			GDSL-like Lipase/Acylhydrolase...		Lus10011998 [exp]	10.7	0.8941
AT3G11340		UGT76B1	UDP-dependent glycosyltransfer...		Lus10040243 [exp]	11.0	0.7807
AT3G56570			SET domain-containing protein ...		Lus10029539 [exp]	12.3	0.8940
AT1G24480			S-adenosyl-L-methionine-depend...		Lus10036941 [exp]	12.5	0.8559
					Lus10032472 [exp]	13.8	0.8932
					Lus10001030 [exp]	14.9	0.7856
AT3G61230	LIM	PLIM2c	PLIM2c, GATA type zinc finger ...		Lus10029859 [exp]	15.7	0.8923

Compare expression of checked genes

Lus10040245 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.