Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G53980 40 / 6e-06 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) AT5G05960 40 / 2e-05 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10004677 [exp] 93 / 4e-26 AT5G05960 142 / 8e-45 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10009872 [exp] 55 / 3e-11 AT5G05960 148 / 2e-47 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10000397 [exp] 55 / 3e-11 AT5G05960 138 / 3e-43 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.010G196300 [exp] 57 / 2e-12 AT5G05960 150 / 2e-48 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.008G061800 [exp] 53 / 1e-10 AT5G05960 155 / 3e-50 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.016G104300 [exp] 42 / 2e-06 AT3G53980 143 / 2e-45 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10040249 pacid=23174205 polypeptide=Lus10040249 locus=Lus10040249.g ID=Lus10040249.BGIv1.0 annot-version=v1.0 ATGGCAGCAATGAAATCCTCTTGCATTTGCCTAGTAGCCTTGTTCGCTGCGGTACTAGTACTTGAAACATCCAACTTTATTGCTGGAGCTGGTACCGAGT GCGGCGCGTCCACGACACCTGACAAGGAAGCATTCAAGCTGGCGCCCTGTGCGTCCGCCGGACAGGACCAAAACGCTGCCGTTCGAACCAATGCTGTGCT CAGATGA
AA sequence Show only first row Show all	>Lus10040249 pacid=23174205 polypeptide=Lus10040249 locus=Lus10040249.g ID=Lus10040249.BGIv1.0 annot-version=v1.0 MAAMKSSCICLVALFAAVLVLETSNFIAGAGTECGASTTPDKEAFKLAPCASAGQDQNAAVRTNAVLR

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G53980			Bifunctional inhibitor/lipid-t...		Lus10040249 [exp]	0	1
AT1G22340		ATUGT85A7	UDP-glucosyl transferase 85A7 ...		Lus10035921 [exp]	5.5	0.9112
AT1G70840		MLP31	MLP-like protein 31 (.1)		Lus10020497 [exp]	7.2	0.9448
AT3G07680			emp24/gp25L/p24 family/GOLD fa...		Lus10036603 [exp]	11.1	0.9362
AT1G16390		3-Oct, ATOCT3	organic cation/carnitine trans...		Lus10005825 [exp]	11.8	0.9300
					Lus10008051 [exp]	12.4	0.9325
AT5G05960			Bifunctional inhibitor/lipid-t...		Lus10004677 [exp]	13.9	0.9248
AT3G22490			Seed maturation protein (.1)		Lus10022058 [exp]	15.5	0.9358
AT1G60790		TBL2	TRICHOME BIREFRINGENCE-LIKE 2,...		Lus10030590 [exp]	18.0	0.9200
AT2G02850		ARPN	plantacyanin (.1)		Lus10022800 [exp]	20.4	0.9335
AT5G15920		EMB2782, SMC5	EMBRYO DEFECTIVE 2782, structu...		Lus10005338 [exp]	21.2	0.9290

Compare expression of checked genes

Lus10040249 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.