Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G59190 46 / 5e-07 subtilase family protein (.1) AT3G46840 40 / 7e-05 Subtilase family protein (.1) AT5G59110 37 / 0.0007 subtilisin-like serine protease-related (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10004686 [exp] 80 / 6e-19 AT5G59100 611 / 0.0 Subtilisin-like serine endopeptidase family protein (.1) Lus10004681 [exp] 43 / 5e-06 AT5G59100 257 / 2e-79 Subtilisin-like serine endopeptidase family protein (.1) Lus10002964 [exp] 42 / 1e-05 AT5G59100 624 / 0.0 Subtilisin-like serine endopeptidase family protein (.1) Lus10040251 [exp] 40 / 5e-05 AT5G59190 438 / 6e-143 subtilase family protein (.1) Lus10004682 [exp] 40 / 5e-05 AT5G59190 555 / 0.0 subtilase family protein (.1) Lus10000395 [exp] 39 / 0.0002 AT4G00230 269 / 1e-84 xylem serine peptidase 1 (.1) Lus10042555 [exp] 38 / 0.0004 AT5G59100 603 / 0.0 Subtilisin-like serine endopeptidase family protein (.1) Lus10004683 [exp] 38 / 0.0004 AT5G59190 600 / 0.0 subtilase family protein (.1) Lus10007045 [exp] 37 / 0.001 AT1G04110 603 / 0.0 STOMATAL DENSITY AND DISTRIBUTION, Subtilase family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.010G196900 [exp] 50 / 1e-08 AT5G59100 657 / 0.0 Subtilisin-like serine endopeptidase family protein (.1) Potri.010G196700 [exp] 48 / 8e-08 AT5G59100 579 / 0.0 Subtilisin-like serine endopeptidase family protein (.1) Potri.010G196800 [exp] 46 / 4e-07 AT5G59100 599 / 0.0 Subtilisin-like serine endopeptidase family protein (.1) Potri.012G133200 [exp] 45 / 1e-06 AT5G59090 646 / 0.0 subtilase 4.12 (.1.2.3) Potri.003G120101 [exp] 40 / 4e-05 AT5G59190 536 / 0.0 subtilase family protein (.1) Potri.009G038001 [exp] 40 / 7e-05 AT3G46850 794 / 0.0 Subtilase family protein (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10040254 pacid=23174021 polypeptide=Lus10040254 locus=Lus10040254.g ID=Lus10040254.BGIv1.0 annot-version=v1.0 ATGATCACAAACGACAATAGCAGCTGTAGTAGTACAAATTCAACTGTTGGGGATTTGAATTACCCTTATTTTACGGCTTCGGTGGTAGCTTCTGAGAGGT GTAGTCGGGTGTTTAATAGGGTTGTAACGAATGTTGGTAGGAGTAATTCAAGTTATAGAGCGGCAGTAGTGGTGGAGACTGTGAGGTTTACGGTGAGAGT GAACCCTGATGTTATGGCATTTGGATTTGTTGGTGAGAGGTTGAAGTTAGTGTTGAAGGTGTGA
AA sequence Show only first row Show all	>Lus10040254 pacid=23174021 polypeptide=Lus10040254 locus=Lus10040254.g ID=Lus10040254.BGIv1.0 annot-version=v1.0 MITNDNSSCSSTNSTVGDLNYPYFTASVVASERCSRVFNRVVTNVGRSNSSYRAAVVVETVRFTVRVNPDVMAFGFVGERLKLVLKV

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G59190			subtilase family protein (.1)		Lus10040254 [exp]	0	1
AT1G21430		YUC11	Flavin-binding monooxygenase f...		Lus10000677 [exp]	4.4	1.0000
AT2G15220			Plant basic secretory protein ...		Lus10001608 [exp]	6.2	1.0000
AT1G79860		ATROPGEF12, ROP...	MATERNAL EFFECT EMBRYO ARREST ...		Lus10037866 [exp]	6.6	0.9710
AT4G35580	NAC	NTL9, CBNAC	NAC transcription factor-like ...		Lus10005144 [exp]	7.5	1.0000
					Lus10024141 [exp]	8.7	1.0000
AT5G06720		ATPA2	peroxidase 2 (.1)		Lus10027988 [exp]	9.7	1.0000
					Lus10013255 [exp]	10.7	1.0000
					Lus10013259 [exp]	11.5	1.0000
AT1G61110	NAC	ANAC025	NAC domain containing protein ...		Lus10013964 [exp]	12.3	1.0000
AT3G06240			F-box family protein (.1)		Lus10014136 [exp]	13.1	1.0000

Compare expression of checked genes

Lus10040254 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.