Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G07410 347 / 5e-123 ATRAB-A2B, AtRABA2b ARABIDOPSIS RAB GTPASE HOMOLOG A2B, RAB GTPase homolog A2B (.1) AT3G46830 344 / 5e-122 ATRAB-A2C, AtRab11A, AtRABA2c ARABIDOPSIS RAB GTPASE HOMOLOG A2C, RAB GTPase homolog A2C (.1) AT5G59150 343 / 2e-121 ATRAB-A2D, AtRABA2d ARABIDOPSIS RAB GTPASE HOMOLOG A2D, RAB GTPase homolog A2D (.1) AT1G09630 338 / 3e-119 ATRAB-A2A, ATRAB11C, ATRABA2A ARABIDOPSIS RAB GTPASE A2A, RAB GTPase 11C (.1) AT1G16920 297 / 3e-103 ATRABA4B, RAB11, ATRABA1B RAB GTPase homolog A1B (.1) AT5G60860 296 / 6e-103 AtRABA1f RAB GTPase homolog A1F (.1) AT3G15060 291 / 6e-101 AtRABA1g RAB GTPase homolog A1G (.1) AT5G45750 290 / 2e-100 AtRABA1c RAB GTPase homolog A1C (.1) AT4G18430 290 / 2e-100 AtRABA1e RAB GTPase homolog A1E (.1) AT4G18800 289 / 4e-100 AthSGBP, AtRab11B, AtRABA1d RAB GTPase homolog A1D (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10004687 [exp] 422 / 2e-152 AT1G07410 363 / 2e-129 ARABIDOPSIS RAB GTPASE HOMOLOG A2B, RAB GTPase homolog A2B (.1) Lus10001026 [exp] 399 / 2e-143 AT1G07410 366 / 2e-130 ARABIDOPSIS RAB GTPASE HOMOLOG A2B, RAB GTPase homolog A2B (.1) Lus10016486 [exp] 359 / 1e-127 AT1G07410 396 / 1e-142 ARABIDOPSIS RAB GTPASE HOMOLOG A2B, RAB GTPase homolog A2B (.1) Lus10040745 [exp] 359 / 1e-127 AT1G07410 394 / 7e-142 ARABIDOPSIS RAB GTPASE HOMOLOG A2B, RAB GTPase homolog A2B (.1) Lus10041116 [exp] 323 / 2e-113 AT1G09630 395 / 4e-142 ARABIDOPSIS RAB GTPASE A2A, RAB GTPase 11C (.1) Lus10036441 [exp] 308 / 3e-107 AT1G09630 387 / 2e-138 ARABIDOPSIS RAB GTPASE A2A, RAB GTPase 11C (.1) Lus10002178 [exp] 300 / 3e-104 AT5G60860 423 / 4e-153 RAB GTPase homolog A1F (.1) Lus10017679 [exp] 297 / 2e-103 AT5G60860 426 / 4e-154 RAB GTPase homolog A1F (.1) Lus10029253 [exp] 297 / 3e-103 AT5G45750 393 / 4e-141 RAB GTPase homolog A1C (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.010G197200 [exp] 390 / 4e-140 AT1G07410 370 / 3e-132 ARABIDOPSIS RAB GTPASE HOMOLOG A2B, RAB GTPase homolog A2B (.1) Potri.008G061300 [exp] 389 / 1e-139 AT1G07410 367 / 9e-131 ARABIDOPSIS RAB GTPASE HOMOLOG A2B, RAB GTPase homolog A2B (.1) Potri.006G000300 [exp] 365 / 3e-130 AT1G07410 400 / 4e-144 ARABIDOPSIS RAB GTPASE HOMOLOG A2B, RAB GTPase homolog A2B (.1) Potri.016G000400 [exp] 360 / 3e-128 AT1G07410 380 / 4e-136 ARABIDOPSIS RAB GTPASE HOMOLOG A2B, RAB GTPase homolog A2B (.1) Potri.003G004100 [exp] 330 / 4e-116 AT1G09630 382 / 6e-137 ARABIDOPSIS RAB GTPASE A2A, RAB GTPase 11C (.1) Potri.011G070300 [exp] 303 / 8e-106 AT5G45750 392 / 1e-140 RAB GTPase homolog A1C (.1) Potri.004G061000 [exp] 298 / 1e-103 AT4G18800 392 / 9e-141 RAB GTPase homolog A1D (.1) Potri.001G374000 [exp] 298 / 1e-103 AT5G60860 417 / 1e-150 RAB GTPase homolog A1F (.1) Potri.019G092500 [exp] 297 / 2e-103 AT5G60860 419 / 2e-151 RAB GTPase homolog A1F (.1) Potri.013G123600 [exp] 297 / 4e-103 AT5G60860 419 / 2e-151 RAB GTPase homolog A1F (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0023 [flax] [poplar] P-loop_NTPase PF00071 [flax] [poplar] Ras Ras family
Representative CDS sequence Show only first row Show all	>Lus10040255 pacid=23173897 polypeptide=Lus10040255 locus=Lus10040255.g ID=Lus10040255.BGIv1.0 annot-version=v1.0 ATGGCATACAAAGTGGATCACGAGTACGATTATCTCTTCAAGATCGTCCTCATCGGCGATTCCGGCGTCGGAAAATCCAATATCCTTTCCAGGTTCACCC GCAACGAATTCTGCCTCGAATCCAAATCCACCATCGGCGTCGAATTCGCCACTCGAACTCTCCAGGTAGAAGGAAAGACTGTGAAGGCGCAGATATGGGA CACGGCGGGGCAAGAGAGGTACAGAGCAATCACCTCCGCCTACTACAGAGGAGCCGTCGGCGCGCTCCTCGTCTACGACATCACCAAGCGGCAGACGTTC GACAACGTCCAGCGGTGGCTCCGCGAGCTCCGTGACCACGCCGATTCCAACATCGTCATCATGCTGGCCGGGAACAAGTCTGATCTGAACCACCTCCGGT CGGTGTCGGCAGAGGACGCACAGGCGATGGCGGAGAAGGAAACACTGTCGTTCCTGGAGACTTCGGCGCTGGAGGCGTTCAACGTCGAGAAGGCGTTCCA GACGATCTTGCTCGACATTTACCAGATCATCAGCAAGAAGGCGCTGGCGGCTCAGGAAGCAGCGAACGCATCGGGAGTCCCGCAGGGAAAGACGATCGAC GTCGCAAATTTGCCCGGTAATGCCAACAACAAAGGATGTTGCTCCGCTTGA
AA sequence Show only first row Show all	>Lus10040255 pacid=23173897 polypeptide=Lus10040255 locus=Lus10040255.g ID=Lus10040255.BGIv1.0 annot-version=v1.0 MAYKVDHEYDYLFKIVLIGDSGVGKSNILSRFTRNEFCLESKSTIGVEFATRTLQVEGKTVKAQIWDTAGQERYRAITSAYYRGAVGALLVYDITKRQTF DNVQRWLRELRDHADSNIVIMLAGNKSDLNHLRSVSAEDAQAMAEKETLSFLETSALEAFNVEKAFQTILLDIYQIISKKALAAQEAANASGVPQGKTID VANLPGNANNKGCCSA

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G07410		ATRAB-A2B, AtRA...	ARABIDOPSIS RAB GTPASE HOMOLOG...		Lus10040255 [exp]	0	1
AT4G39700			Heavy metal transport/detoxifi...		Lus10022508 [exp]	1.4	0.8620
AT4G02590	bHLH	bHLH059, UNE12	unfertilized embryo sac 12, ba...		Lus10002720 [exp]	3.5	0.7858
AT2G31160		OBO1, LSH3	ORGAN BOUNDARY 1, LIGHT SENSIT...		Lus10024901 [exp]	3.7	0.8501
AT4G02590	bHLH	bHLH059, UNE12	unfertilized embryo sac 12, ba...		Lus10014726 [exp]	4.6	0.8025
AT1G05370			Sec14p-like phosphatidylinosit...		Lus10041206 [exp]	5.9	0.8111
AT3G25620		ABCG21	ATP-binding cassette G21, ABC-...		Lus10034387 [exp]	6.0	0.8059
AT4G39950		CYP79B2	"cytochrome P450, family 79, s...		Lus10031726 [exp]	7.3	0.8279
AT1G75290			NAD(P)-binding Rossmann-fold s...		Lus10021709 [exp]	8.7	0.8234
					Lus10007510 [exp]	12.6	0.7645
AT2G34930			disease resistance family prot...		Lus10033931 [exp]	13.0	0.7812

Compare expression of checked genes

Lus10040255 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.