Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G06080 126 / 3e-37 AS2 LBD33 LOB domain-containing protein 33 (.1) AT3G58190 121 / 6e-35 AS2 LBD29, ASL16 ASYMMETRIC LEAVES 2-LIKE 16, lateral organ boundaries-domain 29 (.1) AT2G45420 119 / 2e-33 AS2 LBD18, ASL20 LOB domain-containing protein 18 (.1) AT3G03760 118 / 4e-33 AS2 LBD20 LOB domain-containing protein 20 (.1) AT2G42430 116 / 2e-32 AS2 ASL18, LBD16 ASYMMETRIC LEAVES2-LIKE 18, lateral organ boundaries-domain 16 (.1) AT4G00210 112 / 2e-31 AS2 LBD31 LOB domain-containing protein 31 (.1) AT2G42440 111 / 8e-31 AS2 Lateral organ boundaries (LOB) domain family protein (.1) AT4G00220 108 / 7e-30 AS2 JLO, LBD30, ASL19 LOB DOMAIN-CONTAINING PROTEIN 30, JAGGED LATERAL ORGANS, Lateral organ boundaries (LOB) domain family protein (.1) AT2G45410 105 / 6e-29 AS2 LBD19 LOB domain-containing protein 19 (.1) AT2G31310 102 / 9e-28 AS2 LBD14 LOB domain-containing protein 14 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10004707 [exp] 241 / 2e-82 AT5G06080 154 / 1e-47 LOB domain-containing protein 33 (.1) Lus10000613 [exp] 118 / 1e-33 AT3G58190 215 / 1e-70 ASYMMETRIC LEAVES 2-LIKE 16, lateral organ boundaries-domain 29 (.1) Lus10033873 [exp] 117 / 2e-33 AT3G58190 220 / 1e-72 ASYMMETRIC LEAVES 2-LIKE 16, lateral organ boundaries-domain 29 (.1) Lus10000707 [exp] 117 / 7e-33 AT2G42430 222 / 2e-72 ASYMMETRIC LEAVES2-LIKE 18, lateral organ boundaries-domain 16 (.1) Lus10024877 [exp] 114 / 1e-31 AT2G42430 211 / 6e-68 ASYMMETRIC LEAVES2-LIKE 18, lateral organ boundaries-domain 16 (.1) Lus10009298 [exp] 114 / 1e-31 AT2G45410 193 / 2e-62 LOB domain-containing protein 19 (.1) Lus10033872 [exp] 111 / 1e-30 AT2G42430 212 / 6e-69 ASYMMETRIC LEAVES2-LIKE 18, lateral organ boundaries-domain 16 (.1) Lus10014757 [exp] 109 / 6e-30 AT2G42430 208 / 2e-67 ASYMMETRIC LEAVES2-LIKE 18, lateral organ boundaries-domain 16 (.1) Lus10009930 [exp] 98 / 9e-26 AT2G30340 230 / 5e-76 LOB domain-containing protein 13 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.010G200400 [exp] 162 / 6e-51 AT5G06080 152 / 8e-47 LOB domain-containing protein 33 (.1) Potri.005G221900 [exp] 120 / 1e-34 AT2G42430 209 / 3e-68 ASYMMETRIC LEAVES2-LIKE 18, lateral organ boundaries-domain 16 (.1) Potri.002G041100 [exp] 119 / 4e-34 AT2G42440 186 / 6e-59 Lateral organ boundaries (LOB) domain family protein (.1) Potri.014G070400 [exp] 117 / 8e-33 AT2G45420 237 / 2e-78 LOB domain-containing protein 18 (.1) Potri.002G149000 [exp] 116 / 1e-32 AT2G45420 234 / 2e-77 LOB domain-containing protein 18 (.1) Potri.002G041200 [exp] 115 / 1e-32 AT2G42430 191 / 6e-61 ASYMMETRIC LEAVES2-LIKE 18, lateral organ boundaries-domain 16 (.1) Potri.014G070300 [exp] 114 / 1e-32 AT4G00210 181 / 5e-58 LOB domain-containing protein 31 (.1) Potri.013G064501 [exp] 115 / 2e-32 AT3G03760 209 / 1e-67 LOB domain-containing protein 20 (.1) Potri.002G148900 [exp] 110 / 2e-30 AT4G00210 186 / 2e-59 LOB domain-containing protein 31 (.1) Potri.013G081200 [exp] 101 / 4e-27 AT2G40470 249 / 2e-84 ASYMMETRIC LEAVES2-LIKE 11, LOB domain-containing protein 15 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF03195 [flax] [poplar] LOB Lateral organ boundaries (LOB) domain
Representative CDS sequence Show only first row Show all	>Lus10040274 pacid=23173852 polypeptide=Lus10040274 locus=Lus10040274.g ID=Lus10040274.BGIv1.0 annot-version=v1.0 ATGCAGGAGTGTGTTTTTGCACCTTACTTCAGTTATAACCAGGCTCCATCCCATTTCGGGGCAGTGCATAAGGTGTTTGGTGCAAGCAATGTTTCCAAGC TACTACTTCGCTTACCGGTCAACTTTAGAAGCGATGCTGCCATCACTATTGCTTACCAAGCATTGGCACGTATCCAGGATCCAGCATATGGATGTGTGGC TTACATCATGGCCCTCCAGCAACAGGTCGCCAGCATACAGCAAGAGATCGAAACTCTTAGCCACCAATTGGCTTTGAACTCGGTCACCCAGCTTGCCAGC TGTGGTAGTTTACCTGCAAGTTCTGCATCGAACTACGAGACACAAATTTTCCAGCAGAATCAACAAAGTTTACAGCTTGACAATTCAGAACATATTGCTG GAAGCATAGAGTTCGATAGCAAAATCACATCAGAGCTTTTGTCTCTGTACGGATGGGAAGACCAGAACCCTTTCTGGAACTCTGCACATCACACTTAG
AA sequence Show only first row Show all	>Lus10040274 pacid=23173852 polypeptide=Lus10040274 locus=Lus10040274.g ID=Lus10040274.BGIv1.0 annot-version=v1.0 MQECVFAPYFSYNQAPSHFGAVHKVFGASNVSKLLLRLPVNFRSDAAITIAYQALARIQDPAYGCVAYIMALQQQVASIQQEIETLSHQLALNSVTQLAS CGSLPASSASNYETQIFQQNQQSLQLDNSEHIAGSIEFDSKITSELLSLYGWEDQNPFWNSAHHT

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G06080	AS2	LBD33	LOB domain-containing protein ...		Lus10040274 [exp]	0	1
AT4G37580		UNS2, COP3, HLS...	UNUSUAL SUGAR RESPONSE 2, HOOK...		Lus10002314 [exp]	2.0	0.9022
AT5G06080	AS2	LBD33	LOB domain-containing protein ...		Lus10004707 [exp]	2.8	0.8960
AT5G24550		BGLU32	beta glucosidase 32 (.1)		Lus10012869 [exp]	3.0	0.9276
AT1G68810	bHLH	bHLH030	basic helix-loop-helix (bHLH) ...		Lus10034271 [exp]	5.7	0.8978
AT3G11260	HD	WOX5B, WOX5	WUSCHEL related homeobox 5B, W...		Lus10040219 [exp]	6.7	0.8915
AT1G20180			Protein of unknown function (D...		Lus10017348 [exp]	11.0	0.8307
AT5G51680			hydroxyproline-rich glycoprote...		Lus10015024 [exp]	21.1	0.8863
AT3G62270			HCO3- transporter family (.1)		Lus10038060 [exp]	30.2	0.8167
AT4G10300			RmlC-like cupins superfamily p...		Lus10035660 [exp]	33.2	0.8855
AT1G17020		ATSRG1, SRG1	senescence-related gene 1 (.1)		Lus10015252 [exp]	40.1	0.8484

Compare expression of checked genes

Lus10040274 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.