Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G59850 263 / 9e-93 Ribosomal protein S8 family protein (.1) AT1G07770 263 / 9e-93 RPS15A ribosomal protein S15A (.1.2) AT3G46040 263 / 2e-92 RPS15AD ribosomal protein S15A D (.1) AT2G39590 248 / 2e-86 Ribosomal protein S8 family protein (.1) AT4G29430 148 / 6e-47 RPS15AE ribosomal protein S15A E (.1) AT2G19720 142 / 6e-45 RPS15AB ribosomal protein S15A B (.1) ATCG00770 40 / 5e-05 ATCG00770.1, RPS8 ribosomal protein S8 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10023429 [exp] 267 / 5e-94 AT5G59850 264 / 9e-93 Ribosomal protein S8 family protein (.1) Lus10043001 [exp] 266 / 9e-94 AT1G07770 263 / 1e-92 ribosomal protein S15A (.1.2) Lus10029461 [exp] 266 / 9e-94 AT5G59850 263 / 1e-92 Ribosomal protein S8 family protein (.1) Lus10032503 [exp] 266 / 9e-94 AT1G07770 263 / 1e-92 ribosomal protein S15A (.1.2) Lus10005960 [exp] 266 / 9e-94 AT5G59850 263 / 1e-92 Ribosomal protein S8 family protein (.1) Lus10040543 [exp] 135 / 9e-42 AT4G29430 236 / 4e-82 ribosomal protein S15A E (.1) Lus10000975 [exp] 134 / 1e-41 AT4G29430 235 / 2e-81 ribosomal protein S15A E (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.010G208700 [exp] 259 / 3e-91 AT5G59850 260 / 2e-91 Ribosomal protein S8 family protein (.1) Potri.001G118100 [exp] 259 / 3e-91 AT5G59850 260 / 2e-91 Ribosomal protein S8 family protein (.1) Potri.003G114800 [exp] 259 / 3e-91 AT5G59850 260 / 2e-91 Ribosomal protein S8 family protein (.1) Potri.008G051900 [exp] 257 / 3e-90 AT5G59850 260 / 2e-91 Ribosomal protein S8 family protein (.1) Potri.009G071250 [exp] 135 / 5e-42 AT4G29430 228 / 6e-79 ribosomal protein S15A E (.1) Potri.009G071400 [exp] 135 / 5e-42 AT4G29430 228 / 6e-79 ribosomal protein S15A E (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF00410 [flax] [poplar] Ribosomal_S8 Ribosomal protein S8
Representative CDS sequence Show only first row Show all	>Lus10040309 pacid=23173930 polypeptide=Lus10040309 locus=Lus10040309.g ID=Lus10040309.BGIv1.0 annot-version=v1.0 ATGGTGAGAATCAGCGTGCTGAACGATGCTCTCAAGAGCATGTACAATGCTGAGAAGCGCGGAAAGCGCCAGGTCATGATTAGGCCTTCCTCAAAAGTGA TCATCAAGTTCCTTATCGTCATGCAAAAGCATGGTTACATTGGCGAGTTTGAGTATGTTGATGACCACAGGGCTGGTAAAATTGTTGTGGAGTTGAATGG AAGGCTGAACAAATGTGGAGTCATCAGTCCACGATTTGATATCGGTGTTAAGGAAATTGAGGGCTGGACTGCTAGGTTGCTTCCATCTAGACAGTTCGGA TTCATTGTCCTTACTACCTCTGCTGGAATCATGGACCATGAAGAGGCAAGGAGAAAGAATGTTGGTGGGAAAGTTCTTGGTTTCTTCTACTGA
AA sequence Show only first row Show all	>Lus10040309 pacid=23173930 polypeptide=Lus10040309 locus=Lus10040309.g ID=Lus10040309.BGIv1.0 annot-version=v1.0 MVRISVLNDALKSMYNAEKRGKRQVMIRPSSKVIIKFLIVMQKHGYIGEFEYVDDHRAGKIVVELNGRLNKCGVISPRFDIGVKEIEGWTARLLPSRQFG FIVLTTSAGIMDHEEARRKNVGGKVLGFFY

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G59850			Ribosomal protein S8 family pr...		Lus10040309 [exp]	0	1
AT2G18110			Translation elongation factor...		Lus10037618 [exp]	2.4	0.9421
AT2G32060			Ribosomal protein L7Ae/L30e/S1...		Lus10027800 [exp]	4.2	0.9498
AT4G09320		NDPK1	Nucleoside diphosphate kinase ...		Lus10003844 [exp]	6.6	0.9477
AT5G24510			60S acidic ribosomal protein f...		Lus10028876 [exp]	7.1	0.9432
AT1G48830			Ribosomal protein S7e family p...		Lus10034909 [exp]	8.1	0.9472
AT1G48830			Ribosomal protein S7e family p...		Lus10023638 [exp]	8.9	0.9451
AT4G14320			Zinc-binding ribosomal protein...		Lus10000176 [exp]	10.2	0.9405
AT4G24830			arginosuccinate synthase famil...		Lus10012800 [exp]	10.6	0.9330
AT4G35850			Pentatricopeptide repeat (PPR)...		Lus10022296 [exp]	11.7	0.9277
AT3G53740			Ribosomal protein L36e family ...		Lus10016466 [exp]	12.0	0.9195

Compare expression of checked genes

Lus10040309 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.