Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G28110 133 / 6e-38 SCPL45 serine carboxypeptidase-like 45 (.1.2) AT2G33530 128 / 4e-36 SCPL46 serine carboxypeptidase-like 46 (.1) AT5G42230 85 / 3e-20 SCPL41 serine carboxypeptidase-like 41 (.1) AT1G43780 85 / 4e-20 SCPL44 serine carboxypeptidase-like 44 (.1) AT5G42240 84 / 9e-20 SCPL42 serine carboxypeptidase-like 42 (.1) AT2G24010 68 / 3e-14 SCPL23 serine carboxypeptidase-like 23 (.1) AT2G35780 64 / 9e-13 SCPL26 serine carboxypeptidase-like 26 (.1) AT4G30610 63 / 2e-12 SCPL24, BRS1 SERINE CARBOXYPEPTIDASE 24 PRECURSOR, BRI1 SUPPRESSOR 1, alpha/beta-Hydrolases superfamily protein (.1) AT5G23210 61 / 6e-12 SCPL34 serine carboxypeptidase-like 34 (.1.2.3.4) AT4G15100 61 / 9e-12 SCPL30 serine carboxypeptidase-like 30 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10023444 [exp] 186 / 2e-60 AT5G42230 143 / 6e-40 serine carboxypeptidase-like 41 (.1) Lus10040324 [exp] 182 / 2e-56 AT2G33530 532 / 0.0 serine carboxypeptidase-like 46 (.1) Lus10021856 [exp] 181 / 6e-56 AT1G28110 525 / 0.0 serine carboxypeptidase-like 45 (.1.2) Lus10010331 [exp] 177 / 1e-54 AT1G28110 540 / 0.0 serine carboxypeptidase-like 45 (.1.2) Lus10013395 [exp] 177 / 1e-54 AT1G28110 534 / 0.0 serine carboxypeptidase-like 45 (.1.2) Lus10040326 [exp] 164 / 1e-49 AT2G33530 436 / 2e-150 serine carboxypeptidase-like 46 (.1) Lus10023446 [exp] 164 / 2e-49 AT1G28110 520 / 0.0 serine carboxypeptidase-like 45 (.1.2) Lus10023447 [exp] 162 / 6e-49 AT2G33530 441 / 2e-152 serine carboxypeptidase-like 46 (.1) Lus10023882 [exp] 147 / 4e-42 AT1G48410 444 / 2e-146 ARGONAUTE 1, Stabilizer of iron transporter SufD / Polynucleotidyl transferase (.1.2.3)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.006G036000 [exp] 151 / 9e-45 AT1G28110 548 / 0.0 serine carboxypeptidase-like 45 (.1.2) Potri.016G034600 [exp] 147 / 3e-43 AT1G28110 563 / 0.0 serine carboxypeptidase-like 45 (.1.2) Potri.016G034400 [exp] 146 / 1e-42 AT1G28110 566 / 0.0 serine carboxypeptidase-like 45 (.1.2) Potri.012G105500 [exp] 132 / 2e-37 AT1G28110 751 / 0.0 serine carboxypeptidase-like 45 (.1.2) Potri.015G104700 [exp] 130 / 7e-37 AT1G28110 715 / 0.0 serine carboxypeptidase-like 45 (.1.2) Potri.003G164000 [exp] 128 / 6e-36 AT1G28110 758 / 0.0 serine carboxypeptidase-like 45 (.1.2) Potri.006G036500 [exp] 127 / 8e-36 AT1G28110 619 / 0.0 serine carboxypeptidase-like 45 (.1.2) Potri.006G036400 [exp] 125 / 4e-35 AT2G33530 547 / 0.0 serine carboxypeptidase-like 46 (.1) Potri.001G065900 [exp] 125 / 7e-35 AT1G28110 766 / 0.0 serine carboxypeptidase-like 45 (.1.2) Potri.002G071800 [exp] 82 / 6e-19 AT5G42240 742 / 0.0 serine carboxypeptidase-like 42 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0028 [flax] [poplar] AB_hydrolase PF00450 [flax] [poplar] Peptidase_S10 Serine carboxypeptidase
Representative CDS sequence Show only first row Show all	>Lus10040322 pacid=23174047 polypeptide=Lus10040322 locus=Lus10040322.g ID=Lus10040322.BGIv1.0 annot-version=v1.0 ATGTGGAAAGCAGGGAAGTCCATAGATCTTTGCGTAGAAGACGAGTCGGACACGTACTTGAAAAGGAAAGATGTCCAACAAGCGATGCATGCTCAGCTTG TTGGCGTGACCAGCTGGAGTTTTTGCAGCATTGTGATAAATTACGACAACAGCAACATGGAGATCCCGACGATCAGAGTTGTGGGTTCATTGGTGACTTC AAGGATCCAAGTTCTGGTCTACAGCGGGGATCAAGACTCGGTGATTCCGTTCATAGGAACAAGGACTCTGGTGAATCACTTGGCTAAAGGAATGGGATTG AACACGACAGTTACCTACAAGCCACTGATAAACAGGTCGGTGGATGGACGCAAGTTATGGGGAGAAGAAGCAGCTAGGATTTGCAACCATTAG
AA sequence Show only first row Show all	>Lus10040322 pacid=23174047 polypeptide=Lus10040322 locus=Lus10040322.g ID=Lus10040322.BGIv1.0 annot-version=v1.0 MWKAGKSIDLCVEDESDTYLKRKDVQQAMHAQLVGVTSWSFCSIVINYDNSNMEIPTIRVVGSLVTSRIQVLVYSGDQDSVIPFIGTRTLVNHLAKGMGL NTTVTYKPLINRSVDGRKLWGEEAARICNH

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G28110		SCPL45	serine carboxypeptidase-like 4...		Lus10040322 [exp]	0	1
AT5G49350			Glycine-rich protein family (....		Lus10034447 [exp]	8.9	0.6880
AT1G54540			Late embryogenesis abundant (L...		Lus10031317 [exp]	14.0	0.7694
AT2G16910	bHLH	AMS, bHLH021	ABORTED MICROSPORES, basic hel...		Lus10042395 [exp]	14.2	0.7094
AT5G59540			2-oxoglutarate (2OG) and Fe(II...		Lus10013315 [exp]	17.9	0.7024
AT1G14870		AtPCR2, PCR2	PLANT CADMIUM RESISTANCE 2 (.1...		Lus10021696 [exp]	20.5	0.7581
AT3G11920			glutaredoxin-related (.1)		Lus10029074 [exp]	29.8	0.7314
AT2G33530		SCPL46	serine carboxypeptidase-like 4...		Lus10040323 [exp]	31.3	0.6361
AT5G48450		SKS3	SKU5 similar 3 (.1)		Lus10040424 [exp]	47.8	0.6336
AT3G07200			RING/U-box superfamily protein...		Lus10018271 [exp]	58.1	0.5942
AT3G12690		AGC1.5	AGC kinase 1.5 (.1.2.3)		Lus10001757 [exp]	61.0	0.6881

Compare expression of checked genes

Lus10040322 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.