Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G33530 79 / 6e-19 SCPL46 serine carboxypeptidase-like 46 (.1) AT1G28110 78 / 8e-19 SCPL45 serine carboxypeptidase-like 45 (.1.2) AT1G43780 72 / 2e-16 SCPL44 serine carboxypeptidase-like 44 (.1) AT5G42240 68 / 4e-15 SCPL42 serine carboxypeptidase-like 42 (.1) AT2G12480 67 / 7e-15 SCPL43 serine carboxypeptidase-like 43 (.1.2) AT4G30610 64 / 8e-14 SCPL24, BRS1 SERINE CARBOXYPEPTIDASE 24 PRECURSOR, BRI1 SUPPRESSOR 1, alpha/beta-Hydrolases superfamily protein (.1) AT2G24010 59 / 4e-12 SCPL23 serine carboxypeptidase-like 23 (.1) AT4G30810 58 / 1e-11 SCPL29 serine carboxypeptidase-like 29 (.1) AT5G42230 58 / 1e-11 SCPL41 serine carboxypeptidase-like 41 (.1) AT3G02110 56 / 5e-11 SCPL25 serine carboxypeptidase-like 25 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10010331 [exp] 132 / 2e-38 AT1G28110 540 / 0.0 serine carboxypeptidase-like 45 (.1.2) Lus10021856 [exp] 131 / 3e-38 AT1G28110 525 / 0.0 serine carboxypeptidase-like 45 (.1.2) Lus10040324 [exp] 131 / 4e-38 AT2G33530 532 / 0.0 serine carboxypeptidase-like 46 (.1) Lus10023446 [exp] 127 / 2e-36 AT1G28110 520 / 0.0 serine carboxypeptidase-like 45 (.1.2) Lus10040326 [exp] 124 / 1e-35 AT2G33530 436 / 2e-150 serine carboxypeptidase-like 46 (.1) Lus10023447 [exp] 123 / 3e-35 AT2G33530 441 / 2e-152 serine carboxypeptidase-like 46 (.1) Lus10013395 [exp] 122 / 6e-35 AT1G28110 534 / 0.0 serine carboxypeptidase-like 45 (.1.2) Lus10003302 [exp] 107 / 5e-29 AT1G28110 498 / 2e-174 serine carboxypeptidase-like 45 (.1.2) Lus10030317 [exp] 106 / 5e-29 AT1G28110 501 / 2e-175 serine carboxypeptidase-like 45 (.1.2)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.006G036000 [exp] 94 / 3e-24 AT1G28110 548 / 0.0 serine carboxypeptidase-like 45 (.1.2) Potri.016G034400 [exp] 93 / 5e-24 AT1G28110 566 / 0.0 serine carboxypeptidase-like 45 (.1.2) Potri.016G034600 [exp] 92 / 8e-24 AT1G28110 563 / 0.0 serine carboxypeptidase-like 45 (.1.2) Potri.012G105500 [exp] 88 / 2e-22 AT1G28110 751 / 0.0 serine carboxypeptidase-like 45 (.1.2) Potri.016G034875 [exp] 81 / 1e-21 AT1G28110 117 / 2e-32 serine carboxypeptidase-like 45 (.1.2) Potri.001G065900 [exp] 85 / 3e-21 AT1G28110 766 / 0.0 serine carboxypeptidase-like 45 (.1.2) Potri.003G164000 [exp] 85 / 4e-21 AT1G28110 758 / 0.0 serine carboxypeptidase-like 45 (.1.2) Potri.006G036500 [exp] 85 / 4e-21 AT1G28110 619 / 0.0 serine carboxypeptidase-like 45 (.1.2) Potri.006G036400 [exp] 76 / 7e-18 AT2G33530 547 / 0.0 serine carboxypeptidase-like 46 (.1) Potri.015G104700 [exp] 68 / 2e-15 AT1G28110 715 / 0.0 serine carboxypeptidase-like 45 (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0028 [flax] [poplar] AB_hydrolase PF00450 [flax] [poplar] Peptidase_S10 Serine carboxypeptidase
Representative CDS sequence Show only first row Show all	>Lus10040330 pacid=23173921 polypeptide=Lus10040330 locus=Lus10040330.g ID=Lus10040330.BGIv1.0 annot-version=v1.0 ATGGGATTGAACACGACAGTTTCGTACAAGCCATGGTTCGACACTAACAAACAGGTCGGTGGATGGACCCAAGTTCATGGGGAGAAGAAGCAGCTGGGAT TTGCAACCATTAGAGGTGCATCTCACATGGCTCCATTCTCCTCTCCAAAGAGGTCGCTTGCAATGTTTGCTGCATTCGTTGCTGGGAAATCGTTGGCTGT TTGA
AA sequence Show only first row Show all	>Lus10040330 pacid=23173921 polypeptide=Lus10040330 locus=Lus10040330.g ID=Lus10040330.BGIv1.0 annot-version=v1.0 MGLNTTVSYKPWFDTNKQVGGWTQVHGEKKQLGFATIRGASHMAPFSSPKRSLAMFAAFVAGKSLAV

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G43780		SCPL44	serine carboxypeptidase-like 4...		Lus10040330 [exp]	0	1
AT1G66230	MYB	ATMYB20	myb domain protein 20 (.1)		Lus10004042 [exp]	4.1	1.0000
					Lus10011962 [exp]	5.8	1.0000
AT2G20340			Pyridoxal phosphate (PLP)-depe...		Lus10012601 [exp]	7.1	1.0000
					Lus10022805 [exp]	8.2	1.0000
AT5G05530			RING/U-box superfamily protein...		Lus10024629 [exp]	9.2	1.0000
AT2G15220			Plant basic secretory protein ...		Lus10026579 [exp]	10.1	1.0000
AT1G29460			SAUR-like auxin-responsive pro...		Lus10020430 [exp]	10.2	0.9872
AT2G36620		RPL24A	ribosomal protein L24 (.1)		Lus10014637 [exp]	10.6	1.0000
AT5G04350			Plant self-incompatibility pro...		Lus10029388 [exp]	11.7	1.0000
					Lus10006919 [exp]	11.7	0.9755

Compare expression of checked genes

Lus10040330 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.