Lus10040332 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G34480 290 / 4e-102 Ribosomal protein L18ae/LX family protein (.1)
AT3G14600 283 / 3e-99 Ribosomal protein L18ae/LX family protein (.1)
AT1G29965 282 / 4e-99 Ribosomal protein L18ae/LX family protein (.1)
AT1G29970 282 / 5e-97 RPL18AA 60S ribosomal protein L18A-1 (.1.2.3)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10023457 312 / 6e-111 AT2G34480 337 / 2e-120 Ribosomal protein L18ae/LX family protein (.1)
Lus10019881 312 / 8e-111 AT2G34480 337 / 4e-120 Ribosomal protein L18ae/LX family protein (.1)
Lus10023454 312 / 8e-111 AT2G34480 337 / 4e-120 Ribosomal protein L18ae/LX family protein (.1)
Lus10014035 312 / 4e-108 AT2G34480 338 / 2e-117 Ribosomal protein L18ae/LX family protein (.1)
Lus10023456 160 / 4e-52 AT2G34480 147 / 1e-46 Ribosomal protein L18ae/LX family protein (.1)
Lus10023453 120 / 1e-36 AT2G34480 112 / 4e-33 Ribosomal protein L18ae/LX family protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.002G057600 301 / 2e-106 AT2G34480 342 / 3e-122 Ribosomal protein L18ae/LX family protein (.1)
Potri.004G063400 297 / 7e-105 AT2G34480 345 / 1e-123 Ribosomal protein L18ae/LX family protein (.1)
Potri.004G063300 297 / 7e-105 AT2G34480 345 / 1e-123 Ribosomal protein L18ae/LX family protein (.1)
Potri.011G072400 295 / 3e-104 AT2G34480 349 / 4e-125 Ribosomal protein L18ae/LX family protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF01775 Ribosomal_L18A Ribosomal proteins 50S-L18Ae/60S-L20/60S-L18A
Representative CDS sequence
>Lus10040332 pacid=23174131 polypeptide=Lus10040332 locus=Lus10040332.g ID=Lus10040332.BGIv1.0 annot-version=v1.0
ATGAAGCTGTGGCATACTAATGAGGTTCGCGCCAAATCCAAGTTCTGGTACTTTCTGAGGAAGCTGAAGAAGGTGAAGAAAAGCAATGGCCAGATGCTCG
CTATCAACGAGATTTTCGAGAAGAACCCCACGAAAATCAAGAACTATGGCATTTGGCTGAGATACCAGAGCAGAACAGGATACCACAATATGTACAAGGA
GTTCCGTGACACCACCTTGAACGGAGCTGTAGAACAGATGTACGACGAGATGGCTTCTCGCCACAGGGTGAGGTCTCCTTGCATCCAGATCATCAAGACC
GCCACCATCCCCGCCAAGCTGTGCAAGAGGGAGAGCACCAAGCAGTTCCACAACTCGAAGATCAAGTTCCCCTTGGTGTTCAAGAAGGTTAGGCCACCAA
CCAGGAAGCTGAAGACCACATACAAGGCGTCCAGGCCCAACTTGTTTGTCTAA
AA sequence
>Lus10040332 pacid=23174131 polypeptide=Lus10040332 locus=Lus10040332.g ID=Lus10040332.BGIv1.0 annot-version=v1.0
MKLWHTNEVRAKSKFWYFLRKLKKVKKSNGQMLAINEIFEKNPTKIKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYDEMASRHRVRSPCIQIIKT
ATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPTRKLKTTYKASRPNLFV

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT2G34480 Ribosomal protein L18ae/LX fam... Lus10040332 0 1
AT2G42740 RPL16A ribosomal protein large subuni... Lus10033607 1.4 0.9810
AT1G48830 Ribosomal protein S7e family p... Lus10028789 1.4 0.9780
AT1G17880 ATBTF3 basic transcription factor 3 (... Lus10015123 2.0 0.9719
AT2G42740 RPL16A ribosomal protein large subuni... Lus10017648 2.4 0.9779
AT4G39200 Ribosomal protein S25 family p... Lus10021706 3.7 0.9535
AT3G49470 NACA2 nascent polypeptide-associated... Lus10015579 4.0 0.9531
AT2G34480 Ribosomal protein L18ae/LX fam... Lus10023457 4.9 0.9581
AT3G55280 RPL23A2, RPL23A... RIBOSOMAL PROTEIN L23A2, ribos... Lus10030325 7.1 0.9429
AT1G09690 Translation protein SH3-like f... Lus10029302 7.4 0.9500
AT1G75330 OTC ornithine carbamoyltransferase... Lus10010641 8.5 0.9525

Lus10040332 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.