Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G39350 182 / 3e-55 ABCG1 ATP-binding cassette G1, ABC-2 type transporter family protein (.1) AT2G37360 180 / 2e-54 ABCG2 ATP-binding cassette G2, ABC-2 type transporter family protein (.1) AT5G13580 178 / 1e-53 ABCG6 ATP-binding cassette G6, ABC-2 type transporter family protein (.1) AT3G53510 178 / 1e-53 ABCG20 ATP-binding cassette G20, ABC-2 type transporter family protein (.1) AT3G55090 176 / 1e-52 ABCG16 ATP-binding cassette G16, ABC-2 type transporter family protein (.1) AT3G55100 152 / 2e-44 ABCG17 ATP-binding cassette G17, ABC-2 type transporter family protein (.1) AT3G55110 148 / 1e-42 ABCG18 ATP-binding cassette G18, ABC-2 type transporter family protein (.1) AT3G55130 142 / 1e-40 ABCG19, ATWBC19 ATP-binding cassette G19, white-brown complex homolog 19 (.1) AT2G13610 42 / 2e-05 ABCG5 ATP-binding cassette G5, ABC-2 type transporter family protein (.1) AT5G52860 38 / 0.0005 ABCG8 ATP-binding cassette G8, ABC-2 type transporter family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10023465 [exp] 230 / 8e-73 AT2G39350 1064 / 0.0 ATP-binding cassette G1, ABC-2 type transporter family protein (.1) Lus10001972 [exp] 188 / 2e-61 AT5G13580 430 / 7e-148 ATP-binding cassette G6, ABC-2 type transporter family protein (.1) Lus10030306 [exp] 184 / 2e-58 AT5G13580 573 / 0.0 ATP-binding cassette G6, ABC-2 type transporter family protein (.1) Lus10025281 [exp] 156 / 1e-45 AT2G37360 1035 / 0.0 ATP-binding cassette G2, ABC-2 type transporter family protein (.1) Lus10039859 [exp] 64 / 4e-13 AT2G37360 319 / 5e-97 ATP-binding cassette G2, ABC-2 type transporter family protein (.1) Lus10018624 [exp] 63 / 1e-12 AT2G37360 316 / 7e-96 ATP-binding cassette G2, ABC-2 type transporter family protein (.1) Lus10027545 [exp] 45 / 2e-06 AT5G52860 781 / 0.0 ATP-binding cassette G8, ABC-2 type transporter family protein (.1) Lus10039304 [exp] 45 / 3e-06 AT5G52860 504 / 8e-177 ATP-binding cassette G8, ABC-2 type transporter family protein (.1) Lus10033663 [exp] 42 / 2e-05 AT2G39350 454 / 6e-151 ATP-binding cassette G1, ABC-2 type transporter family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.010G213400 [exp] 181 / 1e-54 AT3G55090 1014 / 0.0 ATP-binding cassette G16, ABC-2 type transporter family protein (.1) Potri.008G047900 [exp] 181 / 2e-54 AT3G55090 1008 / 0.0 ATP-binding cassette G16, ABC-2 type transporter family protein (.1) Potri.014G080200 [exp] 178 / 1e-53 AT2G37360 955 / 0.0 ATP-binding cassette G2, ABC-2 type transporter family protein (.1) Potri.002G156900 [exp] 176 / 7e-53 AT3G53510 950 / 0.0 ATP-binding cassette G20, ABC-2 type transporter family protein (.1) Potri.006G215100 [exp] 171 / 4e-51 AT3G53510 860 / 0.0 ATP-binding cassette G20, ABC-2 type transporter family protein (.1) Potri.015G036100 [exp] 55 / 6e-10 AT2G37360 276 / 2e-81 ATP-binding cassette G2, ABC-2 type transporter family protein (.1) Potri.012G045100 [exp] 55 / 7e-10 AT3G55130 270 / 3e-79 ATP-binding cassette G19, white-brown complex homolog 19 (.1) Potri.007G004800 [exp] 38 / 0.0005 AT3G55100 266 / 5e-79 ATP-binding cassette G17, ABC-2 type transporter family protein (.1) Potri.013G117700 [exp] 38 / 0.0006 AT1G53270 666 / 0.0 ATP-binding cassette G10, ABC-2 type transporter family protein (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10040342 pacid=23173981 polypeptide=Lus10040342 locus=Lus10040342.g ID=Lus10040342.BGIv1.0 annot-version=v1.0 ATGTCGCTTGTGAAGTATCCATACGAGGCCGTTTTGCAGAATGAGTTTCAAAACCCGAATAAATGCTTTGTGAGAGGGGTGCAGATATTTGACAACACGC CGTTAGGTGAGTTCCCGACAGAGACAAAGCTGAGGATGTTGGGAAGTATAAGCTCGTCGATGGGGGTGAGCATAACGGCGTCAACTTGTTTAACGACGGG TGCGGATATACTAAAGCAGCAAGGGATCACGGATTTGAACCGGTGGAACTGCTTGGTTGTTACGGTGGCTTGGGGGTTCTTGTTCAGAATTTTGTTTTAC TTCGCTTTGTTACTGGGGGGTAAAAACAAGAGGAGGTGA
AA sequence Show only first row Show all	>Lus10040342 pacid=23173981 polypeptide=Lus10040342 locus=Lus10040342.g ID=Lus10040342.BGIv1.0 annot-version=v1.0 MSLVKYPYEAVLQNEFQNPNKCFVRGVQIFDNTPLGEFPTETKLRMLGSISSSMGVSITASTCLTTGADILKQQGITDLNRWNCLVVTVAWGFLFRILFY FALLLGGKNKRR

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G39350		ABCG1	ATP-binding cassette G1, ABC-2...		Lus10040342 [exp]	0	1
AT2G39350		ABCG1	ATP-binding cassette G1, ABC-2...		Lus10023465 [exp]	1.7	0.9659
AT2G39350		ABCG1	ATP-binding cassette G1, ABC-2...		Lus10040341 [exp]	2.8	0.9478
AT5G13580		ABCG6	ATP-binding cassette G6, ABC-2...		Lus10001972 [exp]	4.2	0.9636
AT2G37360		ABCG2	ATP-binding cassette G2, ABC-2...		Lus10030307 [exp]	6.5	0.9346
AT5G13580		ABCG6	ATP-binding cassette G6, ABC-2...		Lus10030306 [exp]	6.5	0.9495
AT2G18360			alpha/beta-Hydrolases superfam...		Lus10041747 [exp]	7.7	0.9406
AT1G05260		RCI3A, RCI3	RARE COLD INDUCIBLE GENE 3, Pe...		Lus10027164 [exp]	7.7	0.8902
AT2G35770		SCPL28	serine carboxypeptidase-like 2...		Lus10041412 [exp]	8.2	0.8495
AT1G15460		ATBOR4	ARABIDOPSIS THALIANA REQUIRES ...		Lus10008083 [exp]	10.4	0.8873
AT3G25640			Protein of unknown function, D...		Lus10019166 [exp]	11.6	0.8751

Compare expression of checked genes

Lus10040342 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.