Lus10040363 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G45740 129 / 6e-37 hydrolase family protein / HAD-superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10023480 188 / 2e-59 AT3G45740 448 / 2e-157 hydrolase family protein / HAD-superfamily protein (.1)
Lus10008416 132 / 1e-37 AT3G45740 481 / 2e-169 hydrolase family protein / HAD-superfamily protein (.1)
Lus10001969 76 / 3e-17 AT3G45740 298 / 9e-100 hydrolase family protein / HAD-superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.008G045700 152 / 4e-45 AT3G45740 488 / 3e-172 hydrolase family protein / HAD-superfamily protein (.1)
Potri.010G216000 133 / 3e-38 AT3G45740 466 / 1e-164 hydrolase family protein / HAD-superfamily protein (.1)
PFAM info
Representative CDS sequence
>Lus10040363 pacid=23174100 polypeptide=Lus10040363 locus=Lus10040363.g ID=Lus10040363.BGIv1.0 annot-version=v1.0
ATGAAACTCAAAATTCATCACAGTCCTCTGGAATACGTGTCCTTTGGGAAACCAAAGGCTTCTGTGTTCAAGAACGCTGAAGCTATCCTGAACCAGCTTC
AACCAGCTCATCAATATAGTGACTTCAAAGAATGTGAAGAACCACTGTCCTCATTTCCTCTCCAAACACTTTACATGATTGGCGATAACCCTTACGTCGA
TGTCAAAGGTGCTAACCAGGCGGTTCGAATGTCCACTGAGCTGGTTTTCCTGGGGTTTCAGACTGGACGTCCTTGGTTCTCCATCTTAACAAGGACCGGT
GTCTTCCGTGACGAACACAACCATACCGAGTTTCCTGCCGATCTGGTTGTTGACACTGTAGAAGATGCAGTAGATTACATTGTGAGGAAGGAAAGCATCT
TGTAG
AA sequence
>Lus10040363 pacid=23174100 polypeptide=Lus10040363 locus=Lus10040363.g ID=Lus10040363.BGIv1.0 annot-version=v1.0
MKLKIHHSPLEYVSFGKPKASVFKNAEAILNQLQPAHQYSDFKECEEPLSSFPLQTLYMIGDNPYVDVKGANQAVRMSTELVFLGFQTGRPWFSILTRTG
VFRDEHNHTEFPADLVVDTVEDAVDYIVRKESIL

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT3G45740 hydrolase family protein / HAD... Lus10040363 0 1
AT4G01310 Ribosomal L5P family protein (... Lus10036391 5.0 0.8670
AT2G27550 ATC centroradialis (.1) Lus10020600 7.5 0.8612
AT5G02920 F-box/RNI-like superfamily pro... Lus10035325 9.3 0.8561
Lus10033439 9.8 0.8357
AT5G19875 unknown protein Lus10006311 11.1 0.8542
AT5G44440 FAD-binding Berberine family p... Lus10010643 11.6 0.8498
Lus10038619 13.0 0.8133
AT4G24220 5[beta]-StR, 5[... VEIN PATTERNING 1, Δ4,5-s... Lus10027156 13.2 0.7148
Lus10000169 13.5 0.8094
Lus10020451 14.5 0.8484

Lus10040363 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.