Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G38905 101 / 7e-31 Low temperature and salt responsive protein family (.1) AT3G05880 87 / 6e-25 RCI2A RARE-COLD-INDUCIBLE 2A, Low temperature and salt responsive protein family (.1) AT3G05890 79 / 6e-22 RCI2B RARE-COLD-INDUCIBLE 2B, Low temperature and salt responsive protein family (.1) AT1G57550 74 / 1e-19 Low temperature and salt responsive protein family (.1) AT4G30650 67 / 5e-17 Low temperature and salt responsive protein family (.1) AT4G30660 66 / 1e-16 Low temperature and salt responsive protein family (.1.2) AT2G24040 65 / 4e-16 Low temperature and salt responsive protein family (.1) AT4G28088 64 / 7e-16 Low temperature and salt responsive protein family (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10023489 [exp] 102 / 5e-31 AT2G38905 101 / 7e-31 Low temperature and salt responsive protein family (.1) Lus10029449 [exp] 82 / 9e-23 ND 89 / 1e-25 Lus10019890 [exp] 78 / 2e-21 AT3G05880 85 / 3e-24 RARE-COLD-INDUCIBLE 2A, Low temperature and salt responsive protein family (.1) Lus10014028 [exp] 78 / 3e-21 AT3G05880 84 / 5e-24 RARE-COLD-INDUCIBLE 2A, Low temperature and salt responsive protein family (.1) Lus10029450 [exp] 77 / 5e-21 ND 87 / 6e-25 Lus10005948 [exp] 76 / 5e-20 ND 85 / 5e-23 Lus10036592 [exp] 66 / 3e-16 AT4G30660 116 / 4e-36 Low temperature and salt responsive protein family (.1.2) Lus10035809 [exp] 66 / 3e-16 AT4G30660 116 / 5e-36 Low temperature and salt responsive protein family (.1.2)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.008G044300 [exp] 100 / 2e-30 AT2G38905 100 / 4e-30 Low temperature and salt responsive protein family (.1) Potri.010G217200 [exp] 99 / 1e-29 AT2G38905 98 / 2e-29 Low temperature and salt responsive protein family (.1) Potri.013G001600 [exp] 84 / 1e-23 AT3G05880 70 / 3e-18 RARE-COLD-INDUCIBLE 2A, Low temperature and salt responsive protein family (.1) Potri.005G002100 [exp] 78 / 2e-21 AT3G05880 68 / 1e-17 RARE-COLD-INDUCIBLE 2A, Low temperature and salt responsive protein family (.1) Potri.005G002250 [exp] 77 / 3e-21 AT3G05890 66 / 2e-16 RARE-COLD-INDUCIBLE 2B, Low temperature and salt responsive protein family (.1) Potri.006G182500 [exp] 66 / 2e-16 AT4G28088 91 / 5e-26 Low temperature and salt responsive protein family (.1) Potri.018G105100 [exp] 61 / 1e-14 AT4G28088 91 / 1e-25 Low temperature and salt responsive protein family (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF01679 [flax] [poplar] Pmp3 Proteolipid membrane potential modulator
Representative CDS sequence Show only first row Show all	>Lus10040370 pacid=23174121 polypeptide=Lus10040370 locus=Lus10040370.g ID=Lus10040370.BGIv1.0 annot-version=v1.0 ATGGGTTCAGAGACATTCCTAGAGGTGATACTAGCCATCCTCCTACCGCCGGTCGGAGTCTTCCTCCGGTACGGCTGTGGGGTTGAATTCTGGATATGCT TGTTGCTTACCATACTGGGATATATTCCTGGTATCATATACGCCATCTATGTCCTAGTTGGATAG
AA sequence Show only first row Show all	>Lus10040370 pacid=23174121 polypeptide=Lus10040370 locus=Lus10040370.g ID=Lus10040370.BGIv1.0 annot-version=v1.0 MGSETFLEVILAILLPPVGVFLRYGCGVEFWICLLLTILGYIPGIIYAIYVLVG

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G38905			Low temperature and salt respo...		Lus10040370 [exp]	0	1
AT4G18590			Nucleic acid-binding, OB-fold-...		Lus10022705 [exp]	21.0	0.6603
AT3G19000			2-oxoglutarate (2OG) and Fe(II...		Lus10024230 [exp]	23.4	0.6538
AT5G08640		ATFLS1, FLS	flavonol synthase 1 (.1.2)		Lus10023601 [exp]	35.1	0.6529
					Lus10001343 [exp]	52.3	0.6206
AT1G50660			unknown protein		Lus10002072 [exp]	53.3	0.6278
AT2G38710			AMMECR1 family (.1.2)		Lus10029751 [exp]	57.7	0.6431
AT2G44060			Late embryogenesis abundant pr...		Lus10019367 [exp]	59.1	0.6095
AT3G10520		ATGLB2, ARATHGL...	NON-SYMBIOTIC HAEMOGLOBIN 2, A...		Lus10038655 [exp]	71.4	0.6002
AT5G01740			Nuclear transport factor 2 (NT...		Lus10001261 [exp]	88.4	0.5721
					Lus10028295 [exp]	116.3	0.5906

Compare expression of checked genes

Lus10040370 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.