Lus10040374 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G52300 293 / 2e-103 ATPQ "ATP synthase D chain, mitochondrial", ATP synthase D chain, mitochondrial (.1.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10023492 338 / 8e-121 AT3G52300 295 / 8e-104 "ATP synthase D chain, mitochondrial", ATP synthase D chain, mitochondrial (.1.2)
Lus10023337 311 / 4e-110 AT3G52300 298 / 2e-105 "ATP synthase D chain, mitochondrial", ATP synthase D chain, mitochondrial (.1.2)
Lus10038474 309 / 2e-109 AT3G52300 297 / 7e-105 "ATP synthase D chain, mitochondrial", ATP synthase D chain, mitochondrial (.1.2)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.008G043800 297 / 1e-104 AT3G52300 291 / 3e-102 "ATP synthase D chain, mitochondrial", ATP synthase D chain, mitochondrial (.1.2)
Potri.010G217800 288 / 2e-101 AT3G52300 281 / 1e-98 "ATP synthase D chain, mitochondrial", ATP synthase D chain, mitochondrial (.1.2)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF05873 Mt_ATP-synt_D ATP synthase D chain, mitochondrial (ATP5H)
Representative CDS sequence
>Lus10040374 pacid=23173827 polypeptide=Lus10040374 locus=Lus10040374.g ID=Lus10040374.BGIv1.0 annot-version=v1.0
ATGAGCGGAACGGTGAAGAAAGCAGCTGATGTTGCGTTCAAGGCATCCAAGAACATTGATTGGGAAGGAATGGCCAAGCTCCTCGTCTCCGATGAGGCTC
GCAAGGAGTTCTCCGGCCTCCGTCGTGCTTTCGATGAGGTCAATTCCACTCTCCAGACCAAATTCAGCCAGGAGCCTGAACCCATAGATTGGGAGTATTA
CAGGAAAGGAATCGGCTCACGCTTGGTGGATATGTACAAAGAGGCTTATGACAGCGTCGAAGTCCCGAAGTATGTAGACAAAGTGACACCGGAATACAAG
CCTAAATTTGAGGCCTTGATGGTAGAATTGAAGGAAGCAGAGCAGATGTCTCTCAAGGAGTCCGATCGTTTGGAGAAGGAAATCGCCGAGGTCCAAGAGC
TCAAGAAAAAGATCAGCACCATGACTGCAGACGAGTACTTCGAGAAGCATCCGGAGCTGAAGAAGAAGTTTGACGACGAAATCAGGAACGACTACTGGGG
CTATTGA
AA sequence
>Lus10040374 pacid=23173827 polypeptide=Lus10040374 locus=Lus10040374.g ID=Lus10040374.BGIv1.0 annot-version=v1.0
MSGTVKKAADVAFKASKNIDWEGMAKLLVSDEARKEFSGLRRAFDEVNSTLQTKFSQEPEPIDWEYYRKGIGSRLVDMYKEAYDSVEVPKYVDKVTPEYK
PKFEALMVELKEAEQMSLKESDRLEKEIAEVQELKKKISTMTADEYFEKHPELKKKFDDEIRNDYWGY

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT3G52300 ATPQ "ATP synthase D chain, mitocho... Lus10040374 0 1
AT2G33040 ATP3 gamma subunit of Mt ATP syntha... Lus10042366 1.7 0.9398
AT5G20500 Glutaredoxin family protein (.... Lus10017148 1.7 0.9406
AT3G52300 ATPQ "ATP synthase D chain, mitocho... Lus10023492 2.0 0.9399
AT5G23540 Mov34/MPN/PAD-1 family protein... Lus10031085 7.1 0.8966
AT5G11390 WIT1 WPP domain-interacting protein... Lus10005102 8.5 0.8855
AT1G52600 Peptidase S24/S26A/S26B/S26C f... Lus10011491 9.2 0.8779
AT1G04480 Ribosomal protein L14p/L23e fa... Lus10020499 10.0 0.9183
AT3G60820 PBF1 N-terminal nucleophile aminohy... Lus10015867 12.8 0.8886
AT3G25220 FKBP15-1 FK506-binding protein 15 kD-1 ... Lus10003170 16.5 0.8877
AT5G56710 Ribosomal protein L31e family ... Lus10015698 17.3 0.9175

Lus10040374 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.