Lus10040380 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G06620 379 / 6e-131 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
AT1G06640 361 / 1e-123 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.3)
AT1G06650 358 / 2e-122 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2)
AT2G30830 347 / 2e-118 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
AT5G59540 343 / 1e-116 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2)
AT2G25450 341 / 7e-116 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
AT1G04350 340 / 1e-115 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
AT2G30840 337 / 3e-114 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
AT3G61400 335 / 2e-113 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
AT1G06645 333 / 1e-112 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10023499 615 / 0 AT1G06620 400 / 2e-139 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Lus10040382 615 / 0 AT1G06620 411 / 2e-143 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Lus10022190 409 / 2e-143 AT1G06620 323 / 6e-110 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Lus10022189 402 / 9e-140 AT1G06620 418 / 3e-146 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Lus10022195 351 / 2e-119 AT1G06620 432 / 1e-151 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Lus10022191 349 / 7e-119 AT1G06620 456 / 3e-161 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Lus10021943 348 / 2e-118 AT1G06620 443 / 5e-156 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Lus10027585 348 / 2e-118 AT1G06620 429 / 3e-150 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Lus10037796 336 / 6e-114 AT1G06620 442 / 4e-156 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.008G165400 437 / 1e-153 AT1G06620 444 / 1e-156 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Potri.011G156200 413 / 4e-144 AT1G06650 430 / 7e-151 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2)
Potri.010G073166 372 / 5e-128 AT1G06620 470 / 7e-167 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Potri.010G073300 362 / 5e-124 AT1G06620 455 / 7e-161 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Potri.010G073232 320 / 1e-107 AT1G06620 402 / 7e-140 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Potri.010G073100 317 / 2e-106 AT1G06650 414 / 2e-144 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2)
Potri.013G045000 304 / 2e-101 AT1G06620 369 / 6e-127 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Potri.017G135800 277 / 2e-90 AT1G06620 323 / 1e-108 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Potri.005G222300 276 / 3e-90 AT1G06620 340 / 3e-115 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Potri.010G107500 276 / 7e-90 AT1G03400 302 / 3e-100 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0029 Cupin PF03171 2OG-FeII_Oxy 2OG-Fe(II) oxygenase superfamily
Representative CDS sequence
>Lus10040380 pacid=23173991 polypeptide=Lus10040380 locus=Lus10040380.g ID=Lus10040380.BGIv1.0 annot-version=v1.0
ATGGATAGTAATAGTACTAAACCGGCAGAAATTCCGGATAGGCACACCGAACTGAAAGCCTTCGATGACACCAAACGTGGCGTGAAAGGCCTTGTCGATG
CTGGAATCAAGCAGCTCCCTCGAATATTCAAGCACGATTCGTCGGTACTGATCAACGCGGAACCAGCTGTCTCGAACGATGATGCTGCCAAACTTGCCAT
ACCAGTCATCGACTTTCGGGGCATCCACGAGGATCCACGTGCACGTGCCGATGCTATGAAGCAAGTCCACGATGCTTGCTCAGAGTGGGGATTCTTCCAG
GTGATCAACCACAGAATCCCGGTAACACTCCTCGAGAGTACGATTGATGGAATCCGAAAGTTTCACGAGCAGGATGATGATGCCAAGCAAGAGGTGTACA
GCAGGGACGAGACGAAGCATGTGATGTACAATACCAACTTCGATTTCTACCAAGCTTCAGCAGCTAACTGGAGAGACACTCTCTACTGCAATATTGCGCC
CTTCCCTCCACCCCCTGAGCATCTTCCTGCCATTTGCAGAGATGTAATAATCAACTACACAAAAGAAGTAATGGAACTGGCTCTAACTGTTTTCGAGCTG
ATGTCGGAAGCTCTGGGGCTTGAATCGAACCACCTACGAGACATGGGATGCAGCGATGGACTTTTACTGTCGGGTCATTACTACCCAGAGTGTCCAGAGC
CAGAATCGACATTCGGAATCAGCAAACACACAGACAGTAGTTTCCTGACCGTGCTTCTCCAAGACGAATCGAAAGGACTACAGGCTCTCTACCGGGGCCA
ATGGGTCGATGTTAAACCCATACCTGGATCCTTAGTCCTCAACATGGGAGACATGATCCAGCTGATAACGAACGGCAAGTACAAAAGCGTGTATCATAGA
GTCGTGCCAAAGAGCAGCGGAGCGGCCAGGGTTTCGGTCTCTTGCTTCTTGAGGATGCATCATCTGACGGAAGGCAGTGAGAGGGTGTATGAACCGATCA
AGGAATTGGTGACGGAGGAGAGCCCGGCGATATATAAGGGGACGAGCATACATTACCATGTGACCGACGTCTACTTCGTTGGAATAGACGGCGCCAGTAA
ACTCGACTATTTGAAGATATGA
AA sequence
>Lus10040380 pacid=23173991 polypeptide=Lus10040380 locus=Lus10040380.g ID=Lus10040380.BGIv1.0 annot-version=v1.0
MDSNSTKPAEIPDRHTELKAFDDTKRGVKGLVDAGIKQLPRIFKHDSSVLINAEPAVSNDDAAKLAIPVIDFRGIHEDPRARADAMKQVHDACSEWGFFQ
VINHRIPVTLLESTIDGIRKFHEQDDDAKQEVYSRDETKHVMYNTNFDFYQASAANWRDTLYCNIAPFPPPPEHLPAICRDVIINYTKEVMELALTVFEL
MSEALGLESNHLRDMGCSDGLLLSGHYYPECPEPESTFGISKHTDSSFLTVLLQDESKGLQALYRGQWVDVKPIPGSLVLNMGDMIQLITNGKYKSVYHR
VVPKSSGAARVSVSCFLRMHHLTEGSERVYEPIKELVTEESPAIYKGTSIHYHVTDVYFVGIDGASKLDYLKI

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G06620 2-oxoglutarate (2OG) and Fe(II... Lus10040380 0 1
AT1G34060 Pyridoxal phosphate (PLP)-depe... Lus10007085 1.0 0.9428
AT5G67140 F-box/RNI-like superfamily pro... Lus10039564 1.4 0.9377
AT2G16980 Major facilitator superfamily ... Lus10023994 2.0 0.9071
AT4G33040 Thioredoxin superfamily protei... Lus10013519 3.0 0.9123
AT1G69120 MADS AGL7, AP1 APETALA1, AGAMOUS-like 7, K-bo... Lus10017871 5.5 0.8994
AT5G59050 unknown protein Lus10001626 6.9 0.8811
AT3G11780 MD-2-related lipid recognition... Lus10013596 7.3 0.8557
AT2G39510 nodulin MtN21 /EamA-like trans... Lus10005965 7.4 0.8701
AT2G20610 RTY1, RTY, HLS3... SUPERROOT 1, ROOTY 1, ROOTY, H... Lus10018626 7.7 0.8902
AT2G25625 unknown protein Lus10013129 11.8 0.8897

Lus10040380 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.