Lus10040382 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G06620 396 / 1e-137 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
AT1G06650 377 / 8e-130 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2)
AT1G06640 376 / 1e-129 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.3)
AT2G30830 369 / 8e-127 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
AT1G06645 362 / 2e-124 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
AT1G03410 360 / 8e-123 2A6 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
AT5G59540 357 / 3e-122 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2)
AT1G04350 352 / 4e-120 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
AT5G59530 352 / 4e-120 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
AT2G30840 348 / 1e-118 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10040380 615 / 0 AT1G06620 387 / 4e-134 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Lus10023499 602 / 0 AT1G06620 400 / 2e-139 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Lus10022190 418 / 5e-147 AT1G06620 323 / 6e-110 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Lus10022189 403 / 3e-140 AT1G06620 418 / 3e-146 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Lus10022195 374 / 1e-128 AT1G06620 432 / 1e-151 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Lus10027585 372 / 4e-128 AT1G06620 429 / 3e-150 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Lus10022191 368 / 2e-126 AT1G06620 456 / 3e-161 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Lus10021943 355 / 3e-121 AT1G06620 443 / 5e-156 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Lus10022193 354 / 6e-121 AT1G06620 455 / 1e-160 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.008G165400 436 / 4e-153 AT1G06620 444 / 1e-156 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Potri.011G156200 421 / 2e-147 AT1G06650 430 / 7e-151 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2)
Potri.010G073166 391 / 1e-135 AT1G06620 470 / 7e-167 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Potri.010G073300 385 / 3e-133 AT1G06620 455 / 7e-161 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Potri.010G073232 347 / 2e-118 AT1G06620 402 / 7e-140 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Potri.010G073100 332 / 2e-112 AT1G06650 414 / 2e-144 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2)
Potri.013G045000 315 / 1e-105 AT1G06620 369 / 6e-127 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Potri.017G135800 288 / 1e-94 AT1G06620 323 / 1e-108 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Potri.010G107500 281 / 1e-91 AT1G03400 302 / 3e-100 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Potri.005G222300 280 / 1e-91 AT1G06620 340 / 3e-115 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0029 Cupin PF03171 2OG-FeII_Oxy 2OG-Fe(II) oxygenase superfamily
Representative CDS sequence
>Lus10040382 pacid=23174206 polypeptide=Lus10040382 locus=Lus10040382.g ID=Lus10040382.BGIv1.0 annot-version=v1.0
ATGGCGAGTACCAAACCAGTCGCTTCAGACAGACAAACAGAACTAAAGGCATTCGATAACACCAAACGCGGCGTGAAAGGTCTCGTGGATGCTGGAATCA
AGCAGCTTCCTCGGATATTCAAGCACGATTCGTCGGTGATCAATGCGGAACCCGCTGTACTTTCGAAGGATGATGCTGCCAAACTCGCCATACCGGTCAT
CGACTTCCGGGGCATCCACGAGGATCCGCGTGCACGTACAGCTGCCATGAAGAAAGTCCACGATGCTTGTTCCGAATGGGGATTCTTCCAGGTGATCAAC
CACGGAATACCCGTCTCGCTTCTCGAGAGCGCGATAGACGGGATTCGAAAGTTTCACGAGCAGGATGATGAGGCCAAGGAAGAGTTGTACAGCAGGGACC
CGACAAAGGATGTATTGTACAATACCAACTTCGATTTGTACCAAGCTTCGGCAGCTAACTGGAGAGACTCTCTGTACTGCAATATGGCGCCTGTCCCTCC
ACCCCCTCACCATCTTCCTGCCATTTGCAAAGATGTGGTCATCAACTACTCAAAAGAAGTAATGAAACTAGGGTTAACCATTTTCGAGCTGATGTCGGAA
GCTCTGGGGCTTGAACCGAACCACCTAAGAGACATGGGATGCAGCGATGGACTTTTACTGTCAGGTCATTACTATCCAGAATGCCCAGAGCCAGAATCAA
CATTCGGAATCAGCAAACACACAGACAGTAGTTTCCTGACCGTGCTTCTCCAAGACCAATCGGGTGGACTACAAGCTCTCTACCGAGACCAATGGGTCCA
TGTTCAACCCATACCCGGATCCTTAGTCCTCAATGTCGGAGACATGATCCAGCTGATTACGAACGACAAGTACGAAAGCGTGTACCATAGAGTTGTGCCG
AAGAGCAGCGGACCGGCCAGGATTTCGATCCCTTGCTTCTTCCGAAGGCATCATTTGATGGAAGGTAATGAAAAGGTGTATGAACCGATCAAGGAGCTGG
TGACGGAGGAGAGCCCTGCGATATATAAGGGGACGAGCGTGTATGAGTATGTGACGTGCTTCAACTCCGTTGGGCTTGACGGCACCACGAAACTGGGACA
TTTCAAGATATGA
AA sequence
>Lus10040382 pacid=23174206 polypeptide=Lus10040382 locus=Lus10040382.g ID=Lus10040382.BGIv1.0 annot-version=v1.0
MASTKPVASDRQTELKAFDNTKRGVKGLVDAGIKQLPRIFKHDSSVINAEPAVLSKDDAAKLAIPVIDFRGIHEDPRARTAAMKKVHDACSEWGFFQVIN
HGIPVSLLESAIDGIRKFHEQDDEAKEELYSRDPTKDVLYNTNFDLYQASAANWRDSLYCNMAPVPPPPHHLPAICKDVVINYSKEVMKLGLTIFELMSE
ALGLEPNHLRDMGCSDGLLLSGHYYPECPEPESTFGISKHTDSSFLTVLLQDQSGGLQALYRDQWVHVQPIPGSLVLNVGDMIQLITNDKYESVYHRVVP
KSSGPARISIPCFFRRHHLMEGNEKVYEPIKELVTEESPAIYKGTSVYEYVTCFNSVGLDGTTKLGHFKI

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G06620 2-oxoglutarate (2OG) and Fe(II... Lus10040382 0 1
AT1G26730 EXS (ERD1/XPR1/SYG1) family pr... Lus10004284 4.2 0.7723
AT5G33340 CDR1 CONSTITUTIVE DISEASE RESISTANC... Lus10002612 5.5 0.7719
AT3G20580 COBL10 COBRA-like protein 10 precurso... Lus10043065 7.5 0.7239
AT3G07120 RING/U-box superfamily protein... Lus10038180 8.7 0.6866
Lus10013881 8.9 0.7211
AT1G09510 NAD(P)-binding Rossmann-fold s... Lus10023097 10.9 0.6428
Lus10030782 13.6 0.6620
AT5G20260 Exostosin family protein (.1) Lus10039980 17.9 0.6421
AT1G22400 ATUGT85A1, UGT8... ARABIDOPSIS THALIANA UDP-GLUCO... Lus10013920 19.0 0.6421
AT3G03480 CHAT acetyl CoA:(Z)-3-hexen-1-ol ac... Lus10020334 19.8 0.6031

Lus10040382 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.