Lus10040395 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10040396 94 / 9e-25 AT5G54740 62 / 2e-12 seed storage albumin 5 (.1)
Lus10023513 76 / 1e-17 AT5G54740 60 / 1e-11 seed storage albumin 5 (.1)
Lus10040397 73 / 9e-17 ND 39 / 5e-04
Lus10040411 57 / 2e-10 AT5G54740 59 / 3e-11 seed storage albumin 5 (.1)
Lus10023525 49 / 1e-07 AT5G54740 39 / 3e-04 seed storage albumin 5 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.011G134600 43 / 2e-05 AT5G54740 56 / 2e-10 seed storage albumin 5 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0482 Prolamin PF00234 Tryp_alpha_amyl Protease inhibitor/seed storage/LTP family
Representative CDS sequence
>Lus10040395 pacid=23173853 polypeptide=Lus10040395 locus=Lus10040395.g ID=Lus10040395.BGIv1.0 annot-version=v1.0
ATGGCAAAGTTGATGAACCTAGCAGTAGCCGTAGCGGCAGCATTATTCCTTTTCCTCATCGTAGTCGACGCATCGATCCGTACAACAGTAATCATCGACG
ACGAGGAGCCTAACCAAGGCAGCGGTGGCCAAGAACAACAGCAGTGCGAGCAGGAGTTCCAGGAGCACGAGATGCTGAGGCCTTGCCAGAATTACTTGTG
GGACCAGGTCCAGAGAGGCGGCAGCGGCGGCAGTGGAGGAGGGCAACAGGGAGAACACTTCGAGAGGTGCTGTGATCAGCTTAGGGATATGAGAGCCGAG
TGCTCATGCAGGGGACTCGAGCGTGTCATTGGCCAGATGCGGCAGGACATTCGGCAGCGTGGACAGCAGCAGGAGAGTCGGAGGATGATCCAGAAAGGTG
TGGGCATTGCTAGGGACCTTCCTCAACAGTGTCGTGCTGATCCAAGGCAATGTGAGATTCCGGGTCAGCAGCAGAAACCTGCATGGTTTTTTTAG
AA sequence
>Lus10040395 pacid=23173853 polypeptide=Lus10040395 locus=Lus10040395.g ID=Lus10040395.BGIv1.0 annot-version=v1.0
MAKLMNLAVAVAAALFLFLIVVDASIRTTVIIDDEEPNQGSGGQEQQQCEQEFQEHEMLRPCQNYLWDQVQRGGSGGSGGGQQGEHFERCCDQLRDMRAE
CSCRGLERVIGQMRQDIRQRGQQQESRRMIQKGVGIARDLPQQCRADPRQCEIPGQQQKPAWFF

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT4G27170 SESA4, AT2S4 seed storage albumin 4 (.1) Lus10040395 0 1
Lus10014737 2.2 1.0000
AT1G04520 PDLP2 plasmodesmata-located protein ... Lus10028049 3.2 1.0000
AT3G04060 NAC ANAC046 NAC domain containing protein ... Lus10033699 3.9 1.0000
AT4G16195 Plant self-incompatibility pro... Lus10019768 4.5 1.0000
Lus10021773 5.0 1.0000
Lus10039552 6.0 1.0000
Lus10012677 6.3 0.9903
AT1G08510 FATB fatty acyl-ACP thioesterases B... Lus10035900 6.5 1.0000
Lus10019558 6.9 1.0000
AT5G51710 ATKEA5, KEA5 K+ efflux antiporter 5, ARABID... Lus10008000 7.3 0.9920

Lus10040395 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.