Lus10040407 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10040411 45 / 2e-06 AT5G54740 59 / 3e-11 seed storage albumin 5 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.011G134600 41 / 6e-05 AT5G54740 56 / 2e-10 seed storage albumin 5 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0482 Prolamin PF00234 Tryp_alpha_amyl Protease inhibitor/seed storage/LTP family
Representative CDS sequence
>Lus10040407 pacid=23174122 polypeptide=Lus10040407 locus=Lus10040407.g ID=Lus10040407.BGIv1.0 annot-version=v1.0
ATGGCGACAAAGCCAATCACAAGCCAACTGAACATTTCTTCCGCCGCCGCCGCAGCGGTCCTGCTGCTTATTATTACAACGGCGGCAGAGGCGGCTGATT
CTCCGAAGTGCAAGGAGGAGTACGCGGAGCAAGGGAGTTTAGGGAAGTGCAAGAACTTCATAGGGAGATCTGTGCAGAAAGGCAGCCCATTCATCAGCGT
TCGCGCCTTGCTCAGCTGCTGCAATCAGCTGAGGAAGATGAGTAGCAATGAATGTGTCTGTCAAGGTCTACAGATGGTTCTTCAATCCATGGCGGGCCTG
GCCGCCGACCACCGGTTAGATATGGCCAAGGCTGTGGATATGGCTAGTCAGTTCCCCATCAAATGTGGTCTCTCGTCGTCGTCGTCCCGGCCTTGCAAGC
TCTCCCAACCGGCTGCTCCTTAG
AA sequence
>Lus10040407 pacid=23174122 polypeptide=Lus10040407 locus=Lus10040407.g ID=Lus10040407.BGIv1.0 annot-version=v1.0
MATKPITSQLNISSAAAAAVLLLIITTAAEAADSPKCKEEYAEQGSLGKCKNFIGRSVQKGSPFISVRALLSCCNQLRKMSSNECVCQGLQMVLQSMAGL
AADHRLDMAKAVDMASQFPIKCGLSSSSSRPCKLSQPAAP

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
Lus10040407 0 1
Lus10000273 3.0 1.0000
AT1G53000 AtCKS, KDSB CMP-KDO synthetase, Nucleotide... Lus10040889 4.2 0.9803
AT1G17930 Aminotransferase-like, plant m... Lus10001981 5.3 1.0000
AT1G04670 unknown protein Lus10002298 5.5 1.0000
AT4G13420 HAK5, ATHAK5 high affinity K+ transporter 5... Lus10005194 7.7 1.0000
Lus10027667 8.4 1.0000
Lus10032828 9.0 1.0000
Lus10015682 9.2 1.0000
AT5G51030 NAD(P)-binding Rossmann-fold s... Lus10032524 9.4 1.0000
AT3G04120 GAPC1, GAPC-1, ... glyceraldehyde-3-phosphate deh... Lus10033306 9.5 1.0000

Lus10040407 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.