Lus10040412 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G14145 182 / 2e-60 unknown protein
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10023526 239 / 7e-83 AT4G14145 199 / 7e-67 unknown protein
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.010G223700 179 / 4e-59 AT4G14145 168 / 6e-55 unknown protein
Potri.008G038500 82 / 2e-21 AT4G14145 80 / 8e-21 unknown protein
PFAM info
Representative CDS sequence
>Lus10040412 pacid=23174098 polypeptide=Lus10040412 locus=Lus10040412.g ID=Lus10040412.BGIv1.0 annot-version=v1.0
ATGACAACGATAGAGACAGCAGCCGGCCGCCCGCGGAAGACGGTGGACGGCGGCGTTGTTCCTACTCCCGCCGCTGCTGCTGCAACCAGCAAGGTTGAAC
AGAGCAAAATCGGGTCGTTCAAAAGATGGGGAAGGAGGTATCCGTTTGTGAGATATGGACTCCCCATGATTTCCCTCACTGTGATCGGTGCTCTTGGCCT
TGGTCATCTCTTGCAAGGCAGCAAAGATATTGCTAAAGTAAAAGACGATCAAGAATGGGAGATCATTGAGACTAGGAAGGCACTGTCAAGAACGGGGCCT
GTCAATGCTTATAAACCCAAAAAGATTTCAATGGAAGAGGAGCTGCAGGCTCTGCAGCAGAAAGTGAACATAGACAACTACGAGTACAAGAAAATTCCAA
AGCCAAATGAAAGCTGA
AA sequence
>Lus10040412 pacid=23174098 polypeptide=Lus10040412 locus=Lus10040412.g ID=Lus10040412.BGIv1.0 annot-version=v1.0
MTTIETAAGRPRKTVDGGVVPTPAAAAATSKVEQSKIGSFKRWGRRYPFVRYGLPMISLTVIGALGLGHLLQGSKDIAKVKDDQEWEIIETRKALSRTGP
VNAYKPKKISMEEELQALQQKVNIDNYEYKKIPKPNES

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT4G14145 unknown protein Lus10040412 0 1
AT5G49720 TSD1, IRX2, DEC... TUMOROUS SHOOT DEVELOPMENT 1, ... Lus10026275 1.4 0.7855
AT3G09470 Major facilitator superfamily ... Lus10023760 4.5 0.6809
AT5G38600 Proline-rich spliceosome-assoc... Lus10003067 11.0 0.6631
AT5G65380 MATE efflux family protein (.1... Lus10020951 12.5 0.6609
AT1G20693 HMGBETA1, NFD2,... NUCLEOSOME/CHROMATIN ASSEMBLY ... Lus10016025 15.4 0.7137
AT4G17750 HSF ATHSFA1A, ATHSF... ARABIDOPSIS THALIANA CLASS A H... Lus10023636 16.6 0.6378
Lus10024153 17.4 0.7475
AT5G66200 ARO2 armadillo repeat only 2 (.1) Lus10037086 19.5 0.6923
Lus10022247 20.1 0.5996
AT3G17980 AtC2 Arabidopsis thaliana C2 domain... Lus10009684 20.2 0.6697

Lus10040412 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.