Lus10040421 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10023536 149 / 1e-46 ND /
Lus10000178 149 / 2e-45 ND /
Lus10019772 133 / 4e-36 AT5G50400 287 / 2e-84 ARABIDOPSIS THALIANA PURPLE ACID PHOSPHATASE 27, purple acid phosphatase 27 (.1)
Lus10012947 104 / 3e-29 ND /
Lus10029608 102 / 4e-28 ND /
Lus10025569 103 / 2e-26 AT5G06600 149 / 7e-39 ubiquitin-specific protease 12 (.1.2.3)
Lus10017290 98 / 6e-25 ND /
Lus10013548 99 / 7e-25 AT5G06600 55 / 3e-08 ubiquitin-specific protease 12 (.1.2.3)
Lus10017291 97 / 5e-24 AT5G06600 100 / 3e-22 ubiquitin-specific protease 12 (.1.2.3)
Poplar homologues

No hit found

PFAM info
Representative CDS sequence
>Lus10040421 pacid=23174030 polypeptide=Lus10040421 locus=Lus10040421.g ID=Lus10040421.BGIv1.0 annot-version=v1.0
ATGGAAAAAAGAGTGGGGAGCTGGGTCGCTGCTTTAGTCTGCCGAATGACCGATCCTTCGCAGTGGTCATCACTGCTTATTCCAGCGGGCAGGCCATCGA
TGGTTGACTTGATTGTAGACTTCCAAGCTCCAGGTCCGCTCGAGCTCAAAGCACAACTTGGTTTGGATGAAATTGTATCAGAAGCTGCTGCTACTGATGA
ACCTGAAGTAATTGAGGATGATCAATCTCACCAGTCTACCGACGAATCATTGTCCCAGCCCCTTCAACCAGAGCTGCAGGCAGAGGTATCTAAACTTGGG
GAAGAAGGCTCGAAGCTGGATGTCGAAATTCAGCAATTAACTGCTCGGAGGGCCAAAATTCTCGAACGCGAGAATTCTACTATGGTCGAACTGGAGAAGG
CTAACCAAGAGGCTTCCATGGAACTGGATGAACTGAAGAAGGAAAATGACGAGATGAATCAAGCAGGCAAAAAGCGGATGAGTGCCATGGAGGAACTAGT
TCAGGCTAATGCAAGTTGGAAACTTTTCAAGAATTTAGGATGGAAATAG
AA sequence
>Lus10040421 pacid=23174030 polypeptide=Lus10040421 locus=Lus10040421.g ID=Lus10040421.BGIv1.0 annot-version=v1.0
MEKRVGSWVAALVCRMTDPSQWSSLLIPAGRPSMVDLIVDFQAPGPLELKAQLGLDEIVSEAAATDEPEVIEDDQSHQSTDESLSQPLQPELQAEVSKLG
EEGSKLDVEIQQLTARRAKILERENSTMVELEKANQEASMELDELKKENDEMNQAGKKRMSAMEELVQANASWKLFKNLGWK

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
Lus10040421 0 1
AT1G26930 Galactose oxidase/kelch repeat... Lus10023608 2.2 0.8508
AT3G23730 XTH16 xyloglucan endotransglucosylas... Lus10000678 4.7 0.8287
AT4G05230 Ubiquitin-like superfamily pro... Lus10007641 5.2 0.9072
AT1G79460 ATKS1, ATKS, GA... GA REQUIRING 2, ARABIDOPSIS TH... Lus10006924 7.1 0.7692
AT1G58060 RNA helicase family protein (.... Lus10012694 8.9 0.7300
AT2G34930 disease resistance family prot... Lus10001034 9.8 0.7084
AT1G24590 AP2_ERF ESR2, DRNL, SOB... FOR SUPPRESSOR OF PHYTOCHROMEB... Lus10035076 9.9 0.7077
AT1G22440 Zinc-binding alcohol dehydroge... Lus10009517 11.0 0.8704
AT4G36220 CYP84A1, FAH1, ... ferulic acid 5-hydroxylase 1 (... Lus10000326 11.1 0.8538
AT1G35467 RALFL5 RALF-like 5 (.1) Lus10006213 13.7 0.7131

Lus10040421 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.