Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G21580 130 / 3e-41 Ribosomal protein S25 family protein (.1.2) AT4G39200 130 / 3e-41 Ribosomal protein S25 family protein (.1.2) AT4G34555 129 / 9e-41 Ribosomal protein S25 family protein (.1) AT2G16360 118 / 3e-36 Ribosomal protein S25 family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10023552 [exp] 142 / 4e-46 AT4G39200 169 / 7e-56 Ribosomal protein S25 family protein (.1.2) Lus10021706 [exp] 137 / 7e-44 AT4G39200 161 / 7e-53 Ribosomal protein S25 family protein (.1.2) Lus10035060 [exp] 137 / 7e-44 AT4G39200 161 / 7e-53 Ribosomal protein S25 family protein (.1.2) Lus10034277 [exp] 135 / 2e-43 AT2G21580 157 / 3e-51 Ribosomal protein S25 family protein (.1.2)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.004G157200 [exp] 124 / 7e-39 AT4G39200 135 / 1e-42 Ribosomal protein S25 family protein (.1.2) Potri.009G118900 [exp] 124 / 7e-39 AT4G39200 135 / 1e-42 Ribosomal protein S25 family protein (.1.2) Potri.008G020000 [exp] 123 / 1e-38 AT4G34555 132 / 2e-41 Ribosomal protein S25 family protein (.1) Potri.010G239300 [exp] 122 / 4e-38 AT4G39200 131 / 6e-41 Ribosomal protein S25 family protein (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0123 [flax] [poplar] HTH PF03297 [flax] [poplar] Ribosomal_S25 S25 ribosomal protein
Representative CDS sequence Show only first row Show all	>Lus10040436 pacid=23174055 polypeptide=Lus10040436 locus=Lus10040436.g ID=Lus10040436.BGIv1.0 annot-version=v1.0 ATGGTCCTCTTCGACCAAGCTACATACGACAAGCTTCTCTCTGAAGCTCCCAAGTACAGGCACATCACTCCGTCAATCCTCTCCGATCGTCTGAGGATCA ATGGATCGCTTGCAAGGAGGGCAATCAGGGAACTCATGGCTAAAGGATTGATCAGGATGGTGACTGCACATTCAAGCCAGCAGATTTACACCAGGGCTAC AAACGCCTAG
AA sequence Show only first row Show all	>Lus10040436 pacid=23174055 polypeptide=Lus10040436 locus=Lus10040436.g ID=Lus10040436.BGIv1.0 annot-version=v1.0 MVLFDQATYDKLLSEAPKYRHITPSILSDRLRINGSLARRAIRELMAKGLIRMVTAHSSQQIYTRATNA

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G39200			Ribosomal protein S25 family p...		Lus10040436 [exp]	0	1
AT3G62870			Ribosomal protein L7Ae/L30e/S1...		Lus10010763 [exp]	2.0	0.9677
AT4G16720			Ribosomal protein L23/L15e fam...		Lus10007805 [exp]	4.9	0.9660
AT5G15200			Ribosomal protein S4 (.1.2)		Lus10008624 [exp]	5.5	0.9626
AT5G35530			Ribosomal protein S3 family pr...		Lus10030503 [exp]	7.7	0.9600
AT3G16080			Zinc-binding ribosomal protein...		Lus10037549 [exp]	8.7	0.9528
AT4G32720		ATLA1	La protein 1 (.1.2)		Lus10011685 [exp]	12.3	0.9445
AT2G44120			Ribosomal protein L30/L7 famil...		Lus10004220 [exp]	13.5	0.9526
AT2G20450			Ribosomal protein L14 (.1)		Lus10011807 [exp]	14.8	0.9491
AT1G48830			Ribosomal protein S7e family p...		Lus10034909 [exp]	15.2	0.9474
AT3G11940		AML1, ATRPS5A	ARABIDOPSIS MINUTE-LIKE 1, rib...		Lus10008436 [exp]	15.7	0.9523

Compare expression of checked genes

Lus10040436 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.